BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120921.seq (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 1.9 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 7.9 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 279 EPPTADIYTQQSYSAPSSYQDGGXSAPAAA 368 +PP A +Y SS +GG ++P +A Sbjct: 558 KPPVATMYGSDEEIINSSNDEGGKTSPNSA 587 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.4 bits (43), Expect = 7.9 Identities = 5/16 (31%), Positives = 13/16 (81%) Frame = -3 Query: 315 MIVVYKYQQLVAHMAD 268 ++++Y Y Q+V+H+ + Sbjct: 225 ILIIYYYSQIVSHVVN 240 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,419 Number of Sequences: 438 Number of extensions: 1826 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -