BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120920.seq (654 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC115376-1|AAI15377.1| 954|Homo sapiens C2orf16 protein protein. 33 0.89 AL834384-1|CAD39047.1| 845|Homo sapiens hypothetical protein pr... 33 0.89 AC074091-7|AAX93198.1| 939|Homo sapiens unknown protein. 33 0.89 U78313-1|AAB39748.1| 246|Homo sapiens myogenic repressor I-mf p... 30 6.3 BC007836-1|AAH07836.1| 246|Homo sapiens MyoD family inhibitor p... 30 6.3 AL035588-17|CAI22456.1| 231|Homo sapiens MyoD family inhibitor ... 30 6.3 AL035588-16|CAD92607.1| 185|Homo sapiens MyoD family inhibitor ... 30 6.3 AL035588-15|CAB54148.1| 246|Homo sapiens MyoD family inhibitor ... 30 6.3 AL035588-14|CAO72132.1| 213|Homo sapiens MyoD family inhibitor ... 30 6.3 AL035588-13|CAO72133.1| 142|Homo sapiens MyoD family inhibitor ... 30 6.3 >BC115376-1|AAI15377.1| 954|Homo sapiens C2orf16 protein protein. Length = 954 Score = 33.1 bits (72), Expect = 0.89 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 511 PFKRNYFSQAEIQTRSPTRWAHCSRPSRGC 600 P ++N+ S +E RSP++ HCS P R C Sbjct: 563 PSRKNHSSPSERSWRSPSQRNHCSPPERSC 592 >AL834384-1|CAD39047.1| 845|Homo sapiens hypothetical protein protein. Length = 845 Score = 33.1 bits (72), Expect = 0.89 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 511 PFKRNYFSQAEIQTRSPTRWAHCSRPSRGC 600 P ++N+ S +E RSP++ HCS P R C Sbjct: 454 PSRKNHSSPSERSWRSPSQRNHCSPPERSC 483 >AC074091-7|AAX93198.1| 939|Homo sapiens unknown protein. Length = 939 Score = 33.1 bits (72), Expect = 0.89 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 511 PFKRNYFSQAEIQTRSPTRWAHCSRPSRGC 600 P ++N+ S +E RSP++ HCS P R C Sbjct: 548 PSRKNHSSPSERSWRSPSQRNHCSPPERSC 577 >U78313-1|AAB39748.1| 246|Homo sapiens myogenic repressor I-mf protein. Length = 246 Score = 30.3 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 498 CPNCNQVCRRAQFQDLCKNLLHCRILRSCRCARICT*NCACC 373 C +C C +F LC +L C SC C C CC Sbjct: 164 CVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCL--CCCC 203 >BC007836-1|AAH07836.1| 246|Homo sapiens MyoD family inhibitor protein. Length = 246 Score = 30.3 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 498 CPNCNQVCRRAQFQDLCKNLLHCRILRSCRCARICT*NCACC 373 C +C C +F LC +L C SC C C CC Sbjct: 164 CVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCL--CCCC 203 >AL035588-17|CAI22456.1| 231|Homo sapiens MyoD family inhibitor protein. Length = 231 Score = 30.3 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 498 CPNCNQVCRRAQFQDLCKNLLHCRILRSCRCARICT*NCACC 373 C +C C +F LC +L C SC C C CC Sbjct: 164 CVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCL--CCCC 203 >AL035588-16|CAD92607.1| 185|Homo sapiens MyoD family inhibitor protein. Length = 185 Score = 30.3 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 498 CPNCNQVCRRAQFQDLCKNLLHCRILRSCRCARICT*NCACC 373 C +C C +F LC +L C SC C C CC Sbjct: 103 CVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCL--CCCC 142 >AL035588-15|CAB54148.1| 246|Homo sapiens MyoD family inhibitor protein. Length = 246 Score = 30.3 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 498 CPNCNQVCRRAQFQDLCKNLLHCRILRSCRCARICT*NCACC 373 C +C C +F LC +L C SC C C CC Sbjct: 164 CVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCL--CCCC 203 >AL035588-14|CAO72132.1| 213|Homo sapiens MyoD family inhibitor protein. Length = 213 Score = 30.3 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 498 CPNCNQVCRRAQFQDLCKNLLHCRILRSCRCARICT*NCACC 373 C +C C +F LC +L C SC C C CC Sbjct: 164 CVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCL--CCCC 203 >AL035588-13|CAO72133.1| 142|Homo sapiens MyoD family inhibitor protein. Length = 142 Score = 30.3 bits (65), Expect = 6.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = -1 Query: 498 CPNCNQVCRRAQFQDLCKNLLHCRILRSCRCARICT*NCACC 373 C +C C +F LC +L C SC C C CC Sbjct: 103 CVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCL--CCCC 142 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,378,619 Number of Sequences: 237096 Number of extensions: 1656224 Number of successful extensions: 4524 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4520 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7310122300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -