BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120920.seq (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 25 0.64 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 25 0.84 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 25 0.84 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 25 0.84 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 25 0.84 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 25 0.84 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.1 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 4.5 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 4.5 S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. 22 6.0 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 7.9 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 7.9 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 25.0 bits (52), Expect = 0.64 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -1 Query: 465 QFQDLCKNLLHCRILRSCRCARICT*NCAC 376 +++ C L HC +C C C C C Sbjct: 738 RYEAHCFALCHCCDFDACDCEMTCPAGCKC 767 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.84 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +3 Query: 375 NTHSFKYRYVHNDTNAKFYNVIDFCKGLEI 464 + +++KY Y +N+ N K Y I++ + + I Sbjct: 91 HNNNYKYNYNNNNYNKKLYYNINYIEQIPI 120 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.84 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +3 Query: 375 NTHSFKYRYVHNDTNAKFYNVIDFCKGLEI 464 + +++KY Y +N+ N K Y I++ + + I Sbjct: 91 HNNNYKYNYNNNNYNKKLYYNINYIEQIPI 120 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.84 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +3 Query: 375 NTHSFKYRYVHNDTNAKFYNVIDFCKGLEI 464 + +++KY Y +N+ N K Y I++ + + I Sbjct: 91 HNNNYKYNYNNNNYNKKLYYNINYIEQIPI 120 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.84 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +3 Query: 375 NTHSFKYRYVHNDTNAKFYNVIDFCKGLEI 464 + +++KY Y +N+ N K Y I++ + + I Sbjct: 91 HNNNYKYNYNNNNYNKKLYYNINYIEQIPI 120 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 638 LLLSKFNRIQNFQQPLLGREQCAQ 567 +L + N ++NF QPLL +Q Q Sbjct: 1023 VLQADMNALKNFNQPLLVNDQLGQ 1046 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 36 RICKIQTWTRSRCSIGRTWTGIFFVTL 116 ++ K TWT R +I +T TG F+T+ Sbjct: 487 QVIKQNTWTVFRDAITQTGTGPAFLTI 513 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 524 IIFHKQKSKRDLQLVGRIVRDQ 589 + FH S+R+ + RI+RD+ Sbjct: 274 LFFHPLSSRREFAVSTRILRDE 295 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 625 NLTASKIFNNPCLVANNAPNELEI 554 N+TA+K NN + N N+ ++ Sbjct: 1015 NITATKQLNNKARIGNGPINQSDV 1038 >S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. Length = 46 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 151 IIIAVRCAYLFVNVTKNIPVHVRPIL 74 +I +RC YLF++V V P++ Sbjct: 1 MISMLRCIYLFLSVILITSYFVTPVM 26 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 584 DQAGVVENFGCG*ILTTKATRCC 652 + A VENF G L KA R C Sbjct: 473 NNAVAVENFKGGMYLRLKARRAC 495 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 584 DQAGVVENFGCG*ILTTKATRCC 652 + A VENF G L KA R C Sbjct: 473 NNAVAVENFKGGMYLRLKARRAC 495 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,403 Number of Sequences: 438 Number of extensions: 3613 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -