BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120920.seq (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03990.1 68418.m00379 expressed protein predicted protein, Ar... 30 1.2 At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-rel... 28 4.7 At1g55320.1 68414.m06319 acyl-activating enzyme 18 (AAE18) nearl... 28 6.2 >At5g03990.1 68418.m00379 expressed protein predicted protein, Arabidopsis thaliana Length = 302 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +3 Query: 306 DYKKYHINVQQWSH-----IVKWDSFKCNTHSFKYRYVHN 410 D+ + N W H WD CN +SF Y+ V N Sbjct: 207 DHNNNNTNTDSWDHNNNFKAETWDQKNCNNNSFNYKKVEN 246 >At1g58230.1 68414.m06618 WD-40 repeat family protein / beige-related contains Pfam PF00400: WD domain, G-beta repeat; similar to Lipopolysaccharide-responsive and beige-like anchor protein (CDC4-like protein) (Beige-like protein) (SP:P50851) [Homo sapiens} Length = 1280 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/56 (25%), Positives = 24/56 (42%) Frame = +3 Query: 348 IVKWDSFKCNTHSFKYRYVHNDTNAKFYNVIDFCKGLEIAHDDILDCNWDSXQVTI 515 ++ WD + T + R H + K + D + HDDI+ C + S + I Sbjct: 1070 VMVWDILRMRTPEKRVRNTHAEVLRKDIVIADAPSHILCGHDDIITCLYVSTDLDI 1125 >At1g55320.1 68414.m06319 acyl-activating enzyme 18 (AAE18) nearly identical to acyl-activating enzyme 18 [Arabidopsis thaliana] GI:29893268; similar to acetyl-CoA synthetase [SP|P27095] from Methanothrix soehngenii; contains Pfam AMP-binding enzyme domain PF00501l; identical to cDNA acyl-activating enzyme 18 (At1g55320) GI: 29893267 Length = 725 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 48 IQTWTRSRCSIGRTWTGIFFVTLTNK 125 ++TW R+ C G WT I F T + Sbjct: 452 VKTWKRTNCMEGLNWTKIKFFATTGE 477 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,674,035 Number of Sequences: 28952 Number of extensions: 240602 Number of successful extensions: 628 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -