BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120919.seq (631 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC336.09c |rrn7||RNA polymerase I transcription factor subunit... 29 0.55 SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c... 26 3.9 SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|... 26 3.9 SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharo... 25 6.8 SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha... 25 6.8 >SPBC336.09c |rrn7||RNA polymerase I transcription factor subunit Rrn7 |Schizosaccharomyces pombe|chr 2|||Manual Length = 537 Score = 29.1 bits (62), Expect = 0.55 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 616 KKKRLLYSLHFKWNLWLELSLKIILKKRQKFIE 518 K K ++++ WN+WL KI K++ KF E Sbjct: 358 KYKDSMFTVKTNWNMWLSQVQKINEKEKDKFYE 390 >SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 26.2 bits (55), Expect = 3.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -1 Query: 199 QGATGYWSSFSLVVLGTFPLIVMFLLA 119 Q TG W+ +V+ F ++V+FLLA Sbjct: 146 QNVTGNWTWAHVVICYVFNVLVLFLLA 172 >SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1184 Score = 26.2 bits (55), Expect = 3.9 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = -3 Query: 251 YLEH-SRATHYEDEESKEP 198 Y EH + +HYE+EE +EP Sbjct: 782 YFEHETEPSHYEEEEEEEP 800 >SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 2244 Score = 25.4 bits (53), Expect = 6.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 525 SSKILHRYLNVPNNLMYRRP 466 ++ ++ Y+N+P+N YRRP Sbjct: 1463 ANNMIDMYINLPSNNRYRRP 1482 >SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 846 Score = 25.4 bits (53), Expect = 6.8 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 263 LLIDYLEHSRATHYEDEESKEP 198 LL D+ EHSRA H D S P Sbjct: 126 LLYDFNEHSRAVHKLDISSFHP 147 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,684,527 Number of Sequences: 5004 Number of extensions: 55900 Number of successful extensions: 140 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -