BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120918.seq (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 26 0.90 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 26 1.2 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 26 1.2 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 25 2.8 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 4.8 AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismuta... 24 4.8 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 8.4 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 23 8.4 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 23 8.4 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 23 8.4 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 26.2 bits (55), Expect = 0.90 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%) Frame = -3 Query: 419 IPHGRATRPLGLLDLSVPTVKQNVFIVV---NHLLLAFG-----HFAFVLHDRHYVEDIV 264 IP+ R RP+ L ++++P +Q F +HLLL G F L ++ +D V Sbjct: 556 IPYERTFRPMALSNINLPETEQFRFCNCGWPHHLLLPKGTAEGMKFDLFLMISNFADDTV 615 Query: 263 NVLFSK 246 N F++ Sbjct: 616 NQEFNE 621 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 25.8 bits (54), Expect = 1.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 79 AGRFKGLQKSNMVNMPEQQSSTETAAVCKNE 171 A K + ++ N P+QQS+T C+N+ Sbjct: 118 AAELKNMVLQDISNQPKQQSTTRPLRKCRNK 148 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 25.8 bits (54), Expect = 1.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 79 AGRFKGLQKSNMVNMPEQQSSTETAAVCKNE 171 A K + ++ N P+QQS+T C+N+ Sbjct: 119 AAELKNMVLQDISNQPKQQSTTRPLRKCRNK 149 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 521 KRQRSQFQRAKXDRLRCLPTQIWAELKES 607 +RQR + Q+ K R + LP Q W +++S Sbjct: 190 QRQRWRQQQQKQQRQQRLPAQQWPTVQQS 218 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 496 PTDRLVVLQATTQPIPASK 552 P DR +Q+TT IPASK Sbjct: 1422 PDDRRWSIQSTTGDIPASK 1440 >AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismutase 2 protein. Length = 211 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 389 GLLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVED 270 G + +S P+ + VFI +N + L G F +H++ + D Sbjct: 35 GNVTISQPSCTEPVFIDINVVGLTPGKHGFHIHEKGDLTD 74 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = +3 Query: 228 NCYCKFLGKKNINYILNVMPVMQDERKMSKRKKK 329 NC K K + I + ++Q+E++ +KR+++ Sbjct: 131 NCAMKEQNAKLLEQITGMCQLLQEEKEEAKRREE 164 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 116 TMFDFCKPLKRPACILDDIFF*CPTAWQFVCD 21 TM DF P C+LD I + W C+ Sbjct: 150 TMVDFKLLQVIPYCVLDTITYMMGGYWYMACE 181 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 653 LTSCKTPNKAYRAFRSSLLILPKFALVS 570 L +C A+R FR+ +L LP L S Sbjct: 125 LDNCARAYYAFRTFRAQILNLPPSFLTS 152 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 561 LSXFARWNWLRCRLKNDESIGRPFFYPSF 475 L+ A W+R RL E G P+ PSF Sbjct: 8 LTLLAAVYWIRQRLAYWEKRGVPYVPPSF 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,240 Number of Sequences: 2352 Number of extensions: 15520 Number of successful extensions: 31 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -