BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120918.seq (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 29 0.052 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 29 0.052 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 29 0.052 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 29 0.052 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 29 0.052 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 29 0.052 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 29 0.052 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 29 0.052 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 29 0.052 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 29 0.052 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 28 0.069 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 26 0.28 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 26 0.28 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 26 0.28 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 26 0.28 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 26 0.28 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 1.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 3.4 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 3.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 3.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 7.9 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 7.9 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 7.9 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.052 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 253 K 255 + Sbjct: 118 Q 118 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.052 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 253 K 255 + Sbjct: 118 Q 118 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.052 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 253 K 255 + Sbjct: 118 Q 118 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.052 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 253 K 255 + Sbjct: 118 Q 118 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.052 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 253 K 255 + Sbjct: 118 Q 118 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.052 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 253 K 255 + Sbjct: 118 Q 118 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.052 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 253 K 255 + Sbjct: 118 Q 118 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.052 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 253 K 255 + Sbjct: 118 Q 118 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 28.7 bits (61), Expect = 0.052 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 291 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 350 Query: 253 K 255 + Sbjct: 351 Q 351 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 28.7 bits (61), Expect = 0.052 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 291 KYRETSKERSRNRTERERSKEPKIISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 350 Query: 253 K 255 + Sbjct: 351 Q 351 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.3 bits (60), Expect = 0.069 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSS----YNKSNMDQLIAIVNFLE 252 +++ K N E++ S E + N L N ++ YNK N ++L +N++E Sbjct: 58 KYRETSKERSRNRTERERSKEPKIISNNNPLSNNYNYNNNYNNYNKHNYNKLYYNINYIE 117 Query: 253 K 255 + Sbjct: 118 Q 118 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 255 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 255 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 255 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 255 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +1 Query: 85 RFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSYNKSNMDQLIAIVNFLEK 255 +++ K + E++ S E + L N S+YN +N QL +N++E+ Sbjct: 58 KYRKTSKERSRDRTERERSKEPKII---SSLSNNYNYSNYNNNNYKQLCYNINYIEQ 111 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 326 LLAFGHFAFVLHDRHYVEDIVNVLFS 249 LL + H + D H E +V+++FS Sbjct: 218 LLLYNHARLMSQDNHSKEYLVSIMFS 243 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 73 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 198 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 73 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 198 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 73 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 198 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 73 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 198 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 73 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 198 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 73 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 198 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 73 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 198 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 73 IQAGRFKGLQKSNMVNMPEQQSSTETAAVCKNEKLLNKLESS 198 ++ R K L K + PE + + + K L KLESS Sbjct: 65 LRRAREKKLSKRSKSRSPESRGRSNASNTSKTFILSEKLESS 106 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 2 GTRVCLHHKRIARLL 46 G R+CLHH+ + +L Sbjct: 1094 GLRLCLHHRDLPCVL 1108 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 124 PEQQSSTETAAVCKNEKLLNKLESS 198 P+ + + T+ K L NKLESS Sbjct: 85 PDSRDRSSTSNTSKTVILSNKLESS 109 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 124 PEQQSSTETAAVCKNEKLLNKLESS 198 P+ + + T+ K L NKLESS Sbjct: 85 PDSRDRSNTSNTSKTVILSNKLESS 109 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,492 Number of Sequences: 438 Number of extensions: 4218 Number of successful extensions: 33 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -