BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120918.seq (655 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g27150.1 68415.m03263 aldehyde oxidase 3 (AAO3) identical to ... 30 1.5 At5g17690.1 68418.m02073 like heterochromatin protein (LHP1) ide... 29 2.7 At1g11090.1 68414.m01270 hydrolase, alpha/beta fold family prote... 29 3.6 At4g36010.1 68417.m05127 pathogenesis-related thaumatin family p... 28 4.7 At2g17860.1 68415.m02069 pathogenesis-related thaumatin family p... 28 4.7 At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) 28 6.2 At2g04080.1 68415.m00391 MATE efflux family protein similar to h... 28 6.2 At2g24810.1 68415.m02968 pathogenesis-related thaumatin family p... 27 8.2 >At2g27150.1 68415.m03263 aldehyde oxidase 3 (AAO3) identical to GP:3172044:gnl:PID:d1029570:AB010080 Length = 1332 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/82 (23%), Positives = 35/82 (42%), Gaps = 1/82 (1%) Frame = -3 Query: 509 SRSVGHFFTHLFSVIKNEHKICQF-GRVFHQIPHGRATRPLGLLDLSVPTVKQNVFIVVN 333 S +VG+ F + +I++ H+IC H H + L L S ++ N F + Sbjct: 507 SLAVGYLFEFFYPLIESGHRICSLDSGNKHNNSHVDTVKSLPFLSSSQQVLESNEFKPIG 566 Query: 332 HLLLAFGHFAFVLHDRHYVEDI 267 ++ G + +V+DI Sbjct: 567 EAVIKVGAALQASGEAVFVDDI 588 >At5g17690.1 68418.m02073 like heterochromatin protein (LHP1) identical to like heterochromatin protein LHP1 [Arabidopsis thaliana] GI:15625407; contains Pfam profile PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 445 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 378 IKQPEWPSSPAMWDLVKNTPELADFVFIFDHTEKMGK 488 IK WP + W+ ++N +AD + F+ + K GK Sbjct: 127 IKWRGWPETANTWEPLENLQSIADVIDAFEGSLKPGK 163 >At1g11090.1 68414.m01270 hydrolase, alpha/beta fold family protein similar to monoglyceride lipase from [Homo sapiens] GI:14594904, [Mus musculus] GI:2632162; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 324 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +1 Query: 397 LVARPCGIW*KTRPNWQILCSFLITLKRWVKKW---PTDRLV 513 LVA C I K RP W + FLI + R++ W PT+ L+ Sbjct: 161 LVAPMCKISDKVRPKWPV-DQFLIMISRFLPTWAIVPTEDLL 201 >At4g36010.1 68417.m05127 pathogenesis-related thaumatin family protein similar to receptor serine/threonine kinase PR5K [Arabidopsis thaliana] GI:1235680; contains Pfam profile PF00314: Thaumatin family Length = 301 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -3 Query: 140 EDCCSGMFTMFDFCKPLKRPACILDDIFF*CPTAWQFVCDEDT 12 E CCSG F D CKP + + CP A+ + D+ T Sbjct: 196 EYCCSGAFGTPDTCKPSEYSQFFKNA----CPRAYSYAYDDGT 234 >At2g17860.1 68415.m02069 pathogenesis-related thaumatin family protein similar to receptor serine/threonine kinase PR5K [Arabidopsis thaliana] GI:1235680; contains Pfam profile PF00314: Thaumatin family Length = 253 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -3 Query: 140 EDCCSGMFTMFDFCKPLKRPACILDDIFF--*CPTAWQFVCDEDT 12 E CC+G F D C+P + +FF CPTA+ + D+ T Sbjct: 195 EFCCNGAFGTPDTCQPSEY------SVFFKKTCPTAYSYAYDDGT 233 >At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) Length = 638 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 542 QRAKXDRLRCLPTQIWAELKESCEM 616 Q+A RCL + A+LK+SCE+ Sbjct: 429 QKAMSRHFRCLKDAVAAQLKQSCEL 453 >At2g04080.1 68415.m00391 MATE efflux family protein similar to hypothetical protein GB:AAC27412; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 476 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 337 TTINTFCLTVGTLRSSSPSGLVA 405 T++ + CLT+GTL PSG+ A Sbjct: 287 TSVLSICLTIGTLHYVIPSGVAA 309 >At2g24810.1 68415.m02968 pathogenesis-related thaumatin family protein similar to thaumatin-like protein [Arabidopsis thaliana] GI:2435406; contains Pfam profile PF00314: Thaumatin family Length = 193 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 140 EDCCSGMFTMFDFCKPLKRPACILDDIFF*CPTAWQFVCD 21 E CC+G F+ + C P K CPTA+ +V D Sbjct: 139 EYCCTGAFSKPETCPPTKYSKIFKGA----CPTAYSYVYD 174 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,666,441 Number of Sequences: 28952 Number of extensions: 307524 Number of successful extensions: 844 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -