BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120917.seq (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 4.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 6.3 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 6.3 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 23 6.3 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 6.3 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 8.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 8.4 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.8 bits (49), Expect = 4.8 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -1 Query: 595 ICAIRAPLVRTAAPCWGRSSTQSCCR 518 + A+ A ++R AP W ++ CR Sbjct: 789 LAAVAASIIRYGAPVWTEATDLQWCR 814 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 6.3 Identities = 15/61 (24%), Positives = 25/61 (40%) Frame = -2 Query: 324 VPTLLEPSLTMSSIDSGFSAIYICSIYYRRVRCANWPPGRY*ALRLIVCSRLIPPIRCSA 145 V T+ E M +I + +IC+ R R P + ++C L +R S+ Sbjct: 62 VATIAEMDRIMGNIAGNSTEAFICTPVLSRQRATRAPTTSTWTSKSVLCEELFLFLRRSS 121 Query: 144 L 142 L Sbjct: 122 L 122 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 623 FSCTPECSWNLRNSRTSRSD 564 F CTP S RN+RT+ D Sbjct: 83 FICTPVLSRQRRNARTNNVD 102 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 570 TRGARIAQIPTALWCTRKTR 629 TRG R + PT+ W +R++R Sbjct: 21 TRGRRWPRPPTSCWPSRRSR 40 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -1 Query: 643 NLLSCLVFRVHQSAVGICAIRAPLVRTAA 557 + L+ +V+ +H + C I APL R +A Sbjct: 216 HFLNVMVYDMHGAWDSYCGINAPLYRGSA 244 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 8.4 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 317 VGTNSIFLGTVYD-YGVKSPNAASTSSNVTMTRGTANFDIKEFKS 448 VG S + V D SP + S N +MT+ + DIKE S Sbjct: 635 VGIGSTSVDAVGDAMASSSPASCSPEQNGSMTKTRSYSDIKEATS 679 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 8.4 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 317 VGTNSIFLGTVYD-YGVKSPNAASTSSNVTMTRGTANFDIKEFKS 448 VG S + V D SP + S N +MT+ + DIKE S Sbjct: 635 VGIGSTSVDAVGDAMASSSPASCSPEQNGSMTKTRSYSDIKEATS 679 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,441 Number of Sequences: 2352 Number of extensions: 14672 Number of successful extensions: 43 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -