BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120912.seq (645 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 31 0.14 SPBC18E5.07 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 5.3 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 31.1 bits (67), Expect = 0.14 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = +3 Query: 96 PPGGGHTNIFDSEPEPPRTGRXAVPPSATSTFSXGQGDEPKATNGTSVATN 248 PP G T P T + PP ST S G P + TS T+ Sbjct: 292 PPTGNSTTPVTPTVPPTSTSSTSTPPPPASTSSTGTSSSPLPSTSTSCTTS 342 Score = 31.1 bits (67), Expect = 0.14 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = +3 Query: 96 PPGGGHTNIFDSEPEPPRTGRXAVPPSATSTFSXGQGDEPKATNGTSVATN 248 PP G T P T + PP ST S G P + TS T+ Sbjct: 346 PPTGNSTTPVTPTVPPTSTSSTSTPPPPASTSSTGTSSSPLLSTSTSCTTS 396 >SPBC18E5.07 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 615 Score = 25.8 bits (54), Expect = 5.3 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +1 Query: 91 SAPPVVATLTSSIPNRSHRGPGAVPFHQAQRALSATDKEMSRKXPTAL 234 + P +A TS+IPN GP P Q + S K S+ P AL Sbjct: 16 AVPKSLAGSTSNIPNELFVGPDGRPLSQNAQGAS---KSSSKVVPQAL 60 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,170,871 Number of Sequences: 5004 Number of extensions: 36671 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -