BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120912.seq (645 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02970.1 68416.m00292 phosphate-responsive 1 family protein s... 29 3.5 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 28 6.1 >At3g02970.1 68416.m00292 phosphate-responsive 1 family protein similar to phi-1 (phosphate-induced gene) [Nicotiana tabacum] GI:3759184; contains Pfam profile PF04674: Phosphate-induced protein 1 conserved region Length = 332 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = +3 Query: 27 KMTSTPFNVGLNDGARLSSRVLRPPGGGHTNIFDSEPEPPRTGRXAVPPSATSTFS 194 K +TP+N + SS + P T +F S P TGR V P F+ Sbjct: 251 KSETTPYNDDVKKNHESSSMYIVDPATKCTRVFGSGAFPGFTGRIRVDPITGGAFN 306 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 27.9 bits (59), Expect = 6.1 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 40 HHSTLASMTELVYQAGCS-APPVVATLTSSIPNRSHRGPGAVPFHQAQRALSATD 201 HH +S + LVY + S APP+ L+SS S P VP + + +A + Sbjct: 223 HHQRFSSPSFLVYPSNSSFAPPLQGVLSSS--TESEAVPQQVPAAEGEATTTAPE 275 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,803,034 Number of Sequences: 28952 Number of extensions: 214932 Number of successful extensions: 564 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -