BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120909.seq (647 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 24 1.5 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 24 1.5 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 24 1.5 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.4 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 356 CKLCLTLDG*CCYFIVFSIAVLQLSS*FKLVLLIDYLE 243 CKL LT D CC + ++ + L + + I+Y + Sbjct: 109 CKLWLTCDVLCCTASILNLCAIALDRYWAITDPINYAQ 146 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 356 CKLCLTLDG*CCYFIVFSIAVLQLSS*FKLVLLIDYLE 243 CKL LT D CC + ++ + L + + I+Y + Sbjct: 109 CKLWLTCDVLCCTASILNLCAIALDRYWAITDPINYAQ 146 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 356 CKLCLTLDG*CCYFIVFSIAVLQLSS*FKLVLLIDYLE 243 CKL LT D CC + ++ + L + + I+Y + Sbjct: 109 CKLWLTCDVLCCTASILNLCAIALDRYWAITDPINYAQ 146 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -2 Query: 178 SSFSLVVLGTFPLIVMFLLAISLAIRILCL 89 +S ++ +LGT+ +MF++A S+ IL L Sbjct: 287 TSDAVPLLGTYFNCIMFMVASSVVSTILIL 316 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,367 Number of Sequences: 438 Number of extensions: 3958 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -