BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120907.seq (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47134| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_28145| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.5e-05) 33 0.26 SB_58467| Best HMM Match : 7tm_1 (HMM E-Value=3.6e-10) 29 4.3 SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) 28 5.7 SB_40726| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_2574| Best HMM Match : DUF217 (HMM E-Value=0.066) 27 9.9 SB_1013| Best HMM Match : Peptidase_M1 (HMM E-Value=0.041) 27 9.9 SB_22840| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 9.9 >SB_47134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -1 Query: 612 TRVQLDLRNSRTSRSEQRPRVGVDQAHN 529 +++Q+DL+N RTSR E RV D HN Sbjct: 247 SKLQVDLQNERTSRKETESRVNGDVNHN 274 >SB_28145| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.5e-05) Length = 340 Score = 32.7 bits (71), Expect = 0.26 Identities = 22/71 (30%), Positives = 35/71 (49%) Frame = -3 Query: 496 VLYSFSGRYTFEYNKHGFKFLDIKVCGAARHGHITRCAGRVWRFNSIVVYGAQKNAVSAH 317 ++ S+ R +FE NK+ ++ K C G+I G + +VV G+ NA+ Sbjct: 203 LMRSYKFRLSFE-NKNCVDYITEKYCYPLEKGNIPIVLGGASYDSKLVVPGSYINALDFP 261 Query: 316 FVGALFDYVVY 284 V AL DY+ Y Sbjct: 262 SVKALADYIQY 272 >SB_58467| Best HMM Match : 7tm_1 (HMM E-Value=3.6e-10) Length = 340 Score = 28.7 bits (61), Expect = 4.3 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%) Frame = -1 Query: 498 LSSTVLVGVIPLNTINMDLNSLISKFAVPRVMVTLLDVLAAFGDLTP*SYTVPRKMLLVP 319 L S +LV +I L+ +N+ + SL+ VPR + LL AF D +LL P Sbjct: 35 LVSLLLVVIIGLS-LNLSVISLVMMKKVPRRNMNLLVANMAFSDFL--------SLLLEP 85 Query: 318 TLLEPSLTMSS--IDSGFSAIYICSIYYRRVRCANW 217 + L +T++S I + A C Y + + W Sbjct: 86 SSLLSQMTVNSPWIGVSYLADVTCKFYTFVMNTSTW 121 >SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) Length = 1775 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +2 Query: 260 YIAEKPLSIDDIVKEGSNKVGTNSIFLGTVYDYGVKSPNAASTSSNVTMTRGTANFDIKE 439 +I K L+++ I K+ N GT+ + T DYG S N N R T ++E Sbjct: 1382 HIGRKTLAVNKIDKDDDNDDGTDEVVKQTFDDYG--SRNEVVWHGNRIQERSTKRAALEE 1439 >SB_40726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -1 Query: 177 SRLIPPIR-CSALNWATPRLRNLNLMHSSNRDKSVRAKRSI 58 S ++PP R S+ W PR RNL + S R K R +R++ Sbjct: 156 SVVLPPHRLASSTKWTRPR-RNLEVGDISTRQKWTRPRRNL 195 >SB_2574| Best HMM Match : DUF217 (HMM E-Value=0.066) Length = 225 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 612 TRVQLDLRNSRTSRSEQRPRVG 547 +++Q+DL+N RTSR E R G Sbjct: 49 SKLQVDLQNERTSRKETEDRQG 70 >SB_1013| Best HMM Match : Peptidase_M1 (HMM E-Value=0.041) Length = 999 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 47 ENRVIDRFARTDLSLLDECIKFKFLNRGVAQFRAEQRIGGIRREQT 184 E R +DRF+ + + CI +F R A+ E R+ +R++QT Sbjct: 852 ERRGVDRFSEKPQAQITRCIPHRF--RLTARHSKELRVCMLRQQQT 895 >SB_22840| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4002 Score = 27.5 bits (58), Expect = 9.9 Identities = 19/73 (26%), Positives = 38/73 (52%) Frame = -1 Query: 279 SGFSAIYICSIYYRRVRCANWPPGRY*ALRLIVCSRLIPPIRCSALNWATPRLRNLNLMH 100 SG +A S+Y RR RC++W G + ++ SR+ +R A+ + + + ++ Sbjct: 1135 SGPTAHVTYSMYGRRGRCSHWTGGNWANDVYVILSRV--GVRDQAIGMQSRYIPDRSIRA 1192 Query: 99 SSNRDKSVRAKRS 61 SS D++ +R+ Sbjct: 1193 SSQWDRNHGPERA 1205 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,416,037 Number of Sequences: 59808 Number of extensions: 426043 Number of successful extensions: 1384 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1381 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -