BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120907.seq (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 4.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 6.3 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 8.3 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 8.3 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +3 Query: 531 CVLDRPQHGAAVPNERCANCANPTALWCTRKTRQLQQ 641 CV+ +P++ AA NC+ P + T ++ QQ Sbjct: 1852 CVMRKPEYFAASYALTGMNCSGPAQAYFTEYHQKAQQ 1888 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 6.3 Identities = 15/61 (24%), Positives = 25/61 (40%) Frame = -1 Query: 324 VPTLLEPSLTMSSIDSGFSAIYICSIYYRRVRCANWPPGRY*ALRLIVCSRLIPPIRCSA 145 V T+ E M +I + +IC+ R R P + ++C L +R S+ Sbjct: 62 VATIAEMDRIMGNIAGNSTEAFICTPVLSRQRATRAPTTSTWTSKSVLCEELFLFLRRSS 121 Query: 144 L 142 L Sbjct: 122 L 122 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 8.3 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 317 VGTNSIFLGTVYD-YGVKSPNAASTSSNVTMTRGTANFDIKEFKS 448 VG S + V D SP + S N +MT+ + DIKE S Sbjct: 635 VGIGSTSVDAVGDAMASSSPASCSPEQNGSMTKTRSYSDIKEATS 679 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 8.3 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 317 VGTNSIFLGTVYD-YGVKSPNAASTSSNVTMTRGTANFDIKEFKS 448 VG S + V D SP + S N +MT+ + DIKE S Sbjct: 635 VGIGSTSVDAVGDAMASSSPASCSPEQNGSMTKTRSYSDIKEATS 679 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,257 Number of Sequences: 2352 Number of extensions: 14355 Number of successful extensions: 42 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -