BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120907.seq (648 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF415317-1|ABO26898.1| 74|Homo sapiens T cell receptor beta ch... 31 4.7 AJ415697-1|CAC94597.2| 87|Homo sapiens immunoglobulin kappa ch... 30 6.2 >EF415317-1|ABO26898.1| 74|Homo sapiens T cell receptor beta chain protein. Length = 74 Score = 30.7 bits (66), Expect = 4.7 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 300 LTMSSIDSGFSAIYICSIYYRRVR 229 L MSS++ G SA+Y C+ Y RVR Sbjct: 35 LNMSSLELGDSALYFCASSYNRVR 58 >AJ415697-1|CAC94597.2| 87|Homo sapiens immunoglobulin kappa chain variable region protein. Length = 87 Score = 30.3 bits (65), Expect = 6.2 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -1 Query: 309 EPSLTMSSIDSGFSAIYICSIYYRRVRCANWPPGRY 202 E +LT+SS+ S A+Y C Y NWPPG Y Sbjct: 54 EFTLTISSLQSEDFAVYYCQQYN------NWPPGMY 83 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,060,491 Number of Sequences: 237096 Number of extensions: 1974386 Number of successful extensions: 13874 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13872 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7197658880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -