BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120907.seq (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30260.1 68414.m03701 expressed protein 35 0.054 At3g08870.1 68416.m01031 lectin protein kinase, putative similar... 29 2.7 At5g23890.1 68418.m02806 expressed protein weak similarity to SP... 29 3.5 At1g55810.3 68414.m06396 uracil phosphoribosyltransferase, putat... 28 6.1 At1g55810.2 68414.m06395 uracil phosphoribosyltransferase, putat... 28 6.1 At1g55810.1 68414.m06394 uracil phosphoribosyltransferase, putat... 28 6.1 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 27 8.1 At1g16970.1 68414.m02061 Ku70-like protein identical to Ku70-lik... 27 8.1 >At1g30260.1 68414.m03701 expressed protein Length = 97 Score = 34.7 bits (76), Expect = 0.054 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 7/66 (10%) Frame = +2 Query: 290 DIVKEGSNKVGTNSIFLGTVYDYGVKSP-------NAASTSSNVTMTRGTANFDIKEFKS 448 D +KE +VGT+SIF + + SP + +S S++ + T G F + E + Sbjct: 31 DTIKEEEREVGTDSIFPSSFNSKKISSPFTSPYSSSVSSASASASCTSGLNKFPVTENRG 90 Query: 449 MFIVFK 466 F VFK Sbjct: 91 SFPVFK 96 >At3g08870.1 68416.m01031 lectin protein kinase, putative similar to receptor lectin kinase 3 [Arabidopsis thaliana] gi|4100060|gb|AAD00733; contains protein kinase domain, Pfam:PF00069; contains legume lectins alpha and beta domains, Pfam:PF00138 and Pfam:PF00139 Length = 693 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 499 WHVGFEVDSMIVCLIDPNTGPLFRTRGARIAQI 597 W + F + I+C++D N G F R A++A + Sbjct: 581 WVMEFHTNGGILCVVDQNLGSSFNGREAKLALV 613 >At5g23890.1 68418.m02806 expressed protein weak similarity to SP|P12957 Caldesmon (CDM) {Gallus gallus} Length = 946 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +3 Query: 96 TNALNLNSLTEASPSLGQSSESVESDENKRLNVKLNNARVANLRIAHGD 242 T ++SLT S+ QSS+ + SDE K N + +N + + I D Sbjct: 120 TKKQEMHSLTSQQESMIQSSDEISSDEIKVANSEESNLKDEDKSIESND 168 >At1g55810.3 68414.m06396 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 466 Score = 27.9 bits (59), Expect = 6.1 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 8/80 (10%) Frame = +2 Query: 293 IVKEGSNKVGTNSIFLGTVYDYGVKSPNAAST----SSNVTMTRGTA----NFDIKEFKS 448 +V + S N + L V+DY P+A T SS + +G A N+D K +K+ Sbjct: 75 VVNQDSFYHNVNEVELVRVHDYNFDHPDAFDTEQLLSSMEKLRKGQAVDIPNYDFKSYKN 134 Query: 449 MFIVFKGITPTKTVEDNGML 508 + + P+ + G+L Sbjct: 135 NVFPPRRVNPSDVIILEGIL 154 >At1g55810.2 68414.m06395 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 466 Score = 27.9 bits (59), Expect = 6.1 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 8/80 (10%) Frame = +2 Query: 293 IVKEGSNKVGTNSIFLGTVYDYGVKSPNAAST----SSNVTMTRGTA----NFDIKEFKS 448 +V + S N + L V+DY P+A T SS + +G A N+D K +K+ Sbjct: 75 VVNQDSFYHNVNEVELVRVHDYNFDHPDAFDTEQLLSSMEKLRKGQAVDIPNYDFKSYKN 134 Query: 449 MFIVFKGITPTKTVEDNGML 508 + + P+ + G+L Sbjct: 135 NVFPPRRVNPSDVIILEGIL 154 >At1g55810.1 68414.m06394 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 466 Score = 27.9 bits (59), Expect = 6.1 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 8/80 (10%) Frame = +2 Query: 293 IVKEGSNKVGTNSIFLGTVYDYGVKSPNAAST----SSNVTMTRGTA----NFDIKEFKS 448 +V + S N + L V+DY P+A T SS + +G A N+D K +K+ Sbjct: 75 VVNQDSFYHNVNEVELVRVHDYNFDHPDAFDTEQLLSSMEKLRKGQAVDIPNYDFKSYKN 134 Query: 449 MFIVFKGITPTKTVEDNGML 508 + + P+ + G+L Sbjct: 135 NVFPPRRVNPSDVIILEGIL 154 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 312 LEPSLTMSSIDSGFSAIYICSIYYRRVR 229 L P +T +++ FSA CS YYR R Sbjct: 155 LSPEVTDAALFDSFSAFNSCSSYYRDAR 182 >At1g16970.1 68414.m02061 Ku70-like protein identical to Ku70-like protein GI:12006424 from [Arabidopsis thaliana]; contains Pfam profiles PF03731: Ku70/Ku80 N-terminal alpha/beta domain, PF02735: Ku70/Ku80 beta-barrel domain, PF03730: Ku70/Ku80 C-terminal arm, and PF02037: SAP domain; contains TIGRfam profile TIGR00578: ATP-dependent DNA helicase ii, 70 kDa subunit Length = 621 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 105 LNLNSLTEASPSLGQSSESVESDENKRLNVK 197 LN + LTE PS+GQ E ++ KR+ K Sbjct: 234 LNSDELTEFMPSVGQKLEDMKDQLKKRVLAK 264 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,029,324 Number of Sequences: 28952 Number of extensions: 288969 Number of successful extensions: 762 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -