BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120905.seq (642 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 1.6 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 23 2.8 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 22 3.7 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 6.5 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 8.6 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = +2 Query: 104 LASRILRGFFSGIYTKIMFDDLPNVDRVLQLCL 202 L + ILR + Y K++ D + ++++ +C+ Sbjct: 485 LINSILRKLYKNKYRKLIVDGKKSEEQIVDICI 517 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 513 VLLW*HTVKQSPSGYKYLTQRSV 581 V++W + + P YKYL +++V Sbjct: 452 VIIWSSNLSKRPYIYKYLDKKNV 474 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 134 SGIYTKIMFDDLPNVDRVLQLCLDIYLV 217 SG+Y + L + ++Q CLD L+ Sbjct: 48 SGVYRTDFYKKLSPMRLIVQTCLDFLLL 75 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 29 DKLFPETLNFISG 67 ++L PE LNFI G Sbjct: 364 EELIPEYLNFIKG 376 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -3 Query: 163 VEHDLGVDAGEEAAQYPRREEHERRVQPDYTASGYE 56 V+ + A EEA P + DYTAS E Sbjct: 154 VDSKVFAKAREEATVVPEGSRTPIEIPRDYTASDLE 189 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,759 Number of Sequences: 336 Number of extensions: 2084 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -