BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120903.seq (645 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0977 - 12842948-12843572,12844326-12844741 30 1.4 03_05_1008 - 29644352-29645297,29645381-29645769 29 3.2 >03_02_0977 - 12842948-12843572,12844326-12844741 Length = 346 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 Query: 32 GGVTKTILAGQLACSAGNHAVVSTLLIRHAR 124 G TK ++AG LA +G AVV LL H R Sbjct: 209 GYATKRLVAGLLAVESGQDAVVRGLLFEHRR 239 >03_05_1008 - 29644352-29645297,29645381-29645769 Length = 444 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 40 YKNHPGRSTRLQRWKSRSCLYTADPS-RTVTGSMNNL 147 Y+N PG TR+ + S S L DP+ + +TG MN L Sbjct: 103 YRNAPGVETRVSDFGSTSTLRYLDPNLKLLTGYMNVL 139 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,623,266 Number of Sequences: 37544 Number of extensions: 349330 Number of successful extensions: 824 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -