BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120902.seq (644 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0224 - 23738105-23738273,23738364-23738472,23738702-237388... 28 5.5 01_06_0687 - 31249036-31249341 27 9.7 >04_04_0224 - 23738105-23738273,23738364-23738472,23738702-23738804, 23738895-23738926,23739342-23739592,23739639-23739754, 23740271-23740526,23740760-23740847,23740985-23741062, 23741238-23741313,23741532-23741590,23742639-23742711 Length = 469 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 97 LNREGISTQTNFRNHLLLKDMQ 32 +NREGIS N N LLLK +Q Sbjct: 77 INREGISYYNNLINELLLKGVQ 98 >01_06_0687 - 31249036-31249341 Length = 101 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 582 RFFKSNSANS*VFWIFSSLFTISVTFELCC 493 R K ++ +S V W L TI+ ELCC Sbjct: 36 RMTKPSATSSGVAWTMEDLLTIATGDELCC 65 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,289,030 Number of Sequences: 37544 Number of extensions: 212061 Number of successful extensions: 408 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 408 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -