BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120900.seq (576 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 25 0.46 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 3.3 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 9.9 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 25.0 bits (52), Expect = 0.46 Identities = 17/74 (22%), Positives = 30/74 (40%) Frame = -3 Query: 265 QKYRKMFFTLCMLSVLLA*FSKLLFMETXHLLNSVKKVRPLPSTIKLWLKYFENKKHNES 86 Q+ + FT L +L F+K + + K+ S +++W K K + Sbjct: 127 QRRERTTFTRAQLDLLEGLFAKTRYPDIFMREEVAVKINLPESRVQVWFKNRRAKCRQQL 186 Query: 85 ISSRNNCASKHTFS 44 +N AS+ T S Sbjct: 187 QQQQNKSASRTTTS 200 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/33 (21%), Positives = 17/33 (51%) Frame = -3 Query: 316 VLHNGPKLGHLFDELVAQKYRKMFFTLCMLSVL 218 + H + + +++ K+R FF LC + ++ Sbjct: 341 MFHINSAVNPILYNIISSKFRSGFFKLCGMKIV 373 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -3 Query: 541 WKSXRSNTYNMRXHAKHGS*KN 476 W++ + +T N R H +G+ N Sbjct: 364 WRNNQPSTSNNRWHNNNGNNSN 385 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,016 Number of Sequences: 336 Number of extensions: 2549 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -