BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120900.seq (576 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT015203-1|AAT94432.1| 841|Drosophila melanogaster RE65032p pro... 34 0.16 >BT015203-1|AAT94432.1| 841|Drosophila melanogaster RE65032p protein. Length = 841 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 389 NKIQCFECKCRYXAXSLSTLDEGXQNGWXIFLRP 490 N+ Q +C CR A +S+ + QN W I LRP Sbjct: 1 NRYQDVQCVCRLSAIDISSANRYFQNNWLISLRP 34 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,680,691 Number of Sequences: 53049 Number of extensions: 429695 Number of successful extensions: 1289 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1280 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2276053890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -