BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120899.seq (640 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F12.10c |ade3|min11|phosphoribosylformylglycinamidine synth... 27 3.0 SPAC24H6.07 |rps901|rps9-1, rps9a|40S ribosomal protein S9|Schiz... 26 5.3 SPBC1703.02 |rsc9||RSC complex subunit Rsc9|Schizosaccharomyces ... 25 7.0 >SPAC6F12.10c |ade3|min11|phosphoribosylformylglycinamidine synthase Ade3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1323 Score = 26.6 bits (56), Expect = 3.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 145 YAGFFNQIVRNHKSNFIKRYH 83 + F N I + HK+N+I+ YH Sbjct: 882 FKNFINVITQLHKTNYIQAYH 902 >SPAC24H6.07 |rps901|rps9-1, rps9a|40S ribosomal protein S9|Schizosaccharomyces pombe|chr 1|||Manual Length = 191 Score = 25.8 bits (54), Expect = 5.3 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -2 Query: 510 LGIVGKLYTFRIL*YLTHIRRYKKIIRCSLNFITLFTTKH 391 LG+ ++ R+L + HIR K+I+ + L T KH Sbjct: 116 LGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDTQKH 155 >SPBC1703.02 |rsc9||RSC complex subunit Rsc9|Schizosaccharomyces pombe|chr 2|||Manual Length = 780 Score = 25.4 bits (53), Expect = 7.0 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 388 IMLSRKESNEIETASNNFFVSPYVSQIL 471 ++ S ES +E +S N V+PYVS++L Sbjct: 749 MLFSAIESRVLEVSSLNPAVAPYVSEML 776 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,614,269 Number of Sequences: 5004 Number of extensions: 52714 Number of successful extensions: 131 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -