BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120899.seq (640 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58714| Best HMM Match : Linker_histone (HMM E-Value=5.7e-15) 29 4.2 SB_37195| Best HMM Match : Na_Ca_ex (HMM E-Value=0.56) 27 9.7 >SB_58714| Best HMM Match : Linker_histone (HMM E-Value=5.7e-15) Length = 169 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 447 IAVCESNIKVFGKCKVSRQSPNKYVVDNLNLIVNK 551 + + S +K G SRQ+ NKY+V NL NK Sbjct: 14 VDMISSAVKNLGGKGASRQAINKYIVKEFNLTENK 48 >SB_37195| Best HMM Match : Na_Ca_ex (HMM E-Value=0.56) Length = 298 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 370 FYLDTFRTTCPKETHTFFRPTI 305 F L F+T CP E+H FR ++ Sbjct: 64 FVLLAFQTLCPSESHPLFRRSV 85 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,823,353 Number of Sequences: 59808 Number of extensions: 367924 Number of successful extensions: 815 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -