BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120899.seq (640 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 24 3.5 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 23 8.2 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 24.2 bits (50), Expect = 3.5 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -1 Query: 544 TIKFKLSTTYLFGDCRETLHFPNTLIFDSHTA 449 +++F +Y ++ HF N +++D H A Sbjct: 197 SVEFSAGVSYDIPRISKSFHFLNVMVYDMHGA 228 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 23.0 bits (47), Expect = 8.2 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +2 Query: 17 KYVSNVVYEYTNNYYMVDNRVFVVTFDKIRFMISYNLVKETGIEIP 154 KY+ NV+ E Y V++ V + D + + + K T ++IP Sbjct: 364 KYLDNVIDETLRKYPPVESLTRVPSVDYLIPGTKHVIPKRTLVQIP 409 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 661,079 Number of Sequences: 2352 Number of extensions: 12887 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -