BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120896.seq (638 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.3 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 23 3.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.6 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 2.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 245 SLSTFKNSFSKASSPGQPILNGTFILLRTFLATGA 349 +L T + S +K + G + NG F+L R L+ A Sbjct: 384 NLHTLELSDNKLRTVGAQLFNGLFVLNRLTLSGNA 418 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = -3 Query: 402 KKASLIYNTIEQSNGFYYAPVAKNVRSKMNVPFRI 298 ++ASL + + F + + K RS + +PF + Sbjct: 232 RRASLFCGLQKYTRSFAHQSINKEARSNLYLPFHL 266 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = -3 Query: 402 KKASLIYNTIEQSNGFYYAPVAKNVRSKMNVPFRI 298 ++ASL + + F + + K RS + +PF + Sbjct: 227 RRASLFCGLQKYTRSFAHQSINKEARSNLYLPFHL 261 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = -3 Query: 90 SNIYFLYVIWNLLFYIVVLIYV 25 +NIY++ ++ LFY++V + + Sbjct: 111 TNIYYIIILAWALFYLLVSLRI 132 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = -3 Query: 90 SNIYFLYVIWNLLFYIVVLIYV 25 +NIY++ ++ LFY++V + + Sbjct: 164 TNIYYIIILAWALFYLLVSLRI 185 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/49 (24%), Positives = 20/49 (40%) Frame = -2 Query: 526 QLTTNRFNFKHSTYVCHLYNGSSITMDSKEWRIRRNVSIGNKESLTYLQ 380 QL +R + + Y + TM +WR + + K L YL+ Sbjct: 7 QLLKSRESLLSNAYKQGFCQPTQRTMSKIQWRKPKPAMVEEKTQLRYLE 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,163 Number of Sequences: 438 Number of extensions: 4195 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -