BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120894.seq (560 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97002-4|AAB52267.1| 630|Caenorhabditis elegans Hypothetical pr... 29 2.3 Z77661-11|CAB01190.2| 1099|Caenorhabditis elegans Hypothetical p... 28 4.0 >U97002-4|AAB52267.1| 630|Caenorhabditis elegans Hypothetical protein K09H11.4 protein. Length = 630 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +3 Query: 3 QHHPPRRHNGSPRGNRHQQFPSQASTLPISGKFQAHVKS 119 + HPP+ H GSP Q P P G+F ++++ Sbjct: 531 EQHPPQSH-GSPHPGPQYQGPPPRKEFPTPGRFVTNIRA 568 >Z77661-11|CAB01190.2| 1099|Caenorhabditis elegans Hypothetical protein F40G12.3 protein. Length = 1099 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/66 (25%), Positives = 32/66 (48%) Frame = +2 Query: 32 LPSWKPPSAISVTSFNFTHIR*IPSSCKILIPYSSSMAFTNLVDTLANTIHRDAITAPLV 211 L S+ S I+ T+ NFT I S P S+S + + +++ H A+T+ Sbjct: 832 LESYHFQSTITATTINFTGTSEISSELTPTSPGSASKTTSGMAKRASSSKHPSAVTSSAR 891 Query: 212 ETAISN 229 +A+++ Sbjct: 892 SSAVTS 897 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,252,288 Number of Sequences: 27780 Number of extensions: 236218 Number of successful extensions: 522 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1155524042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -