BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120894.seq (560 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor prot... 23 2.1 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.8 >U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor protein. Length = 95 Score = 23.0 bits (47), Expect = 2.1 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 507 EAQGQADFVGCLCHELGIYLIWVK 436 +A G + VGC+C + +W K Sbjct: 69 KAGGHCEKVGCICRKTSFKDLWDK 92 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 2.8 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = +3 Query: 387 GSPSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP----GLLA*HGFHQFSRHSRQH 554 G P G Q PSQ P SG Q + QQ L P + H + + +QH Sbjct: 49 GGPPGAPPSQNPSQMMISPASGIHQMQQL-LQQHILSPTQLQSFMQQHSLY-LQQQQQQH 106 Query: 555 H 557 H Sbjct: 107 H 107 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,412 Number of Sequences: 438 Number of extensions: 2731 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -