BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120892.seq (610 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P41709 Cluster: Uncharacterized 9.4 kDa protein in PE38... 75 1e-12 >UniRef50_P41709 Cluster: Uncharacterized 9.4 kDa protein in PE38 3'region; n=5; Nucleopolyhedrovirus|Rep: Uncharacterized 9.4 kDa protein in PE38 3'region - Autographa californica nuclear polyhedrosis virus (AcMNPV) Length = 81 Score = 75.4 bits (177), Expect = 1e-12 Identities = 40/63 (63%), Positives = 42/63 (66%), Gaps = 5/63 (7%) Frame = -1 Query: 541 PLHYQCDINADKXXXXXXXXXXXTPNKKFIINHNHE--QVDETNKQEVVDKT---DATTY 377 PLHYQCD NADK PNK+FIINHNHE QV+ETNKQ VVDKT D TY Sbjct: 16 PLHYQCDNNADKDVVNAYDTIDVDPNKRFIINHNHEQQQVNETNKQ-VVDKTFINDTATY 74 Query: 376 NSC 368 NSC Sbjct: 75 NSC 77 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 448,354,499 Number of Sequences: 1657284 Number of extensions: 6837936 Number of successful extensions: 10174 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 9763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10167 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 43562448615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -