BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120890.seq (648 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41553-2|AAA83292.1| 476|Caenorhabditis elegans Hypothetical pr... 29 2.8 U58755-13|AAB00702.1| 348|Caenorhabditis elegans Collagen prote... 28 6.6 >U41553-2|AAA83292.1| 476|Caenorhabditis elegans Hypothetical protein ZK1193.3 protein. Length = 476 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = -2 Query: 377 PLSVLNELFTASXSNSVVXXHXY---LTYLNSVSSTTYPSTDTVCNRSAVAADQKIAETS 207 P+ + T +N++ H Y + NS+ S P T+T C+ + +A K E S Sbjct: 117 PIFFQKFILTVVSNNAITFSHEYDIGEDFANSIRSLVAPPTETECDDALLAGISKTLENS 176 >U58755-13|AAB00702.1| 348|Caenorhabditis elegans Collagen protein 113 protein. Length = 348 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 191 CPEIELRFQQFFDPPLQQSDYRPCPWT 271 CPE +F PP++Q Y P P T Sbjct: 289 CPERNAGVNKFEPPPIEQPSYEPQPST 315 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,081,889 Number of Sequences: 27780 Number of extensions: 237421 Number of successful extensions: 630 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -