BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120890.seq (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.5 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 5.9 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 5.9 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = -2 Query: 335 NSVVXXHXYLTYLNSVSSTTYPSTDTVCNRSAVAADQKIAETSIQFR 195 +SV+ YLT+ +S PST + S+V + +++ S++ R Sbjct: 802 DSVIPRILYLTWYSSNGDIKVPSTKVLAMISSVKSFMELSLRSVKDR 848 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 103 VHAALVLCSIVVFVFKHLQQICNVNLL 23 V A + +C+ VFVF L + C VN++ Sbjct: 307 VDAFMSVCT--VFVFMALMEYCLVNIV 331 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/28 (25%), Positives = 16/28 (57%) Frame = +1 Query: 229 SAATAERLQTVSVDGYVVLDTELRYVKY 312 S ++ L +S+D Y+ + ++Y K+ Sbjct: 270 STSSIFNLVAISIDRYIAVTQPIKYAKH 297 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,687 Number of Sequences: 438 Number of extensions: 2893 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -