BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120889.seq (590 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of act... 23 2.6 AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity mod... 23 2.6 >AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of activity of ets genes protein. Length = 108 Score = 22.6 bits (46), Expect = 2.6 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = -3 Query: 435 FLSNG----VVTTGIFVARXFLXXXXLFXMKQLSVCASADLINN 316 FL NG +++ G+F++R L L+ QL +CA+ +N+ Sbjct: 65 FLMNGKALCLMSLGMFLSRVPLGGKLLYKDFQLRLCAALYGVNH 108 >AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity modulator protein. Length = 108 Score = 22.6 bits (46), Expect = 2.6 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = -3 Query: 435 FLSNG----VVTTGIFVARXFLXXXXLFXMKQLSVCASADLINN 316 FL NG +++ G+F++R L L+ QL +CA+ +N+ Sbjct: 65 FLMNGKALCLMSLGMFLSRVPLGGKLLYKDFQLRLCAALYGVNH 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,783 Number of Sequences: 336 Number of extensions: 2809 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -