BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120885.seq (643 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 28 5.6 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 >SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) Length = 1458 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = -1 Query: 559 KRYSSILTKTDYLKTQSLAIIGIW*FDNLKTTSINFNIKHVTFLYYI 419 KRY+ L ++ + +W DN K + + K T+ Y+I Sbjct: 548 KRYNETLVMEKKIRDLGFKDVSVWEHDNPKLSDMTLEKKFTTYPYFI 594 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -1 Query: 451 NIKHVTFLYYIKTSEVSRGTRMERSSFRLISEG 353 N+K + L IK E+ RGTR E S+ R I G Sbjct: 1473 NVKQMQELLNIKDMELRRGTRGEASASRWIFSG 1505 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,816,716 Number of Sequences: 59808 Number of extensions: 260320 Number of successful extensions: 311 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 311 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -