Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120884.seq
         (274 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q75BR3 Cluster: ACR208Cp; n=1; Eremothecium gossypii|Re...    31   6.6  

>UniRef50_Q75BR3 Cluster: ACR208Cp; n=1; Eremothecium gossypii|Rep:
           ACR208Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 241

 Score = 30.7 bits (66), Expect = 6.6
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 2/57 (3%)
 Frame = +1

Query: 79  IWCXRLARRYKSA*IYF*SGDCIQSVCNXXAXPRLCLTKDH--HIPXXGMNTILKTM 243
           I+  R AR  + A   F  G CI ++CN    P + +  DH  +I    +   L+TM
Sbjct: 169 IFLSRHARHARLATFRFSLGLCINAICNMVGAPMVLIVPDHTVYIHLPRLRNTLRTM 225


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,499,271
Number of Sequences: 1657284
Number of extensions: 2369582
Number of successful extensions: 3423
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3409
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3423
length of database: 575,637,011
effective HSP length: 68
effective length of database: 462,941,699
effective search space used: 10184717378
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)