BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120884.seq (274 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q75BR3 Cluster: ACR208Cp; n=1; Eremothecium gossypii|Re... 31 6.6 >UniRef50_Q75BR3 Cluster: ACR208Cp; n=1; Eremothecium gossypii|Rep: ACR208Cp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 241 Score = 30.7 bits (66), Expect = 6.6 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +1 Query: 79 IWCXRLARRYKSA*IYF*SGDCIQSVCNXXAXPRLCLTKDH--HIPXXGMNTILKTM 243 I+ R AR + A F G CI ++CN P + + DH +I + L+TM Sbjct: 169 IFLSRHARHARLATFRFSLGLCINAICNMVGAPMVLIVPDHTVYIHLPRLRNTLRTM 225 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,499,271 Number of Sequences: 1657284 Number of extensions: 2369582 Number of successful extensions: 3423 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3423 length of database: 575,637,011 effective HSP length: 68 effective length of database: 462,941,699 effective search space used: 10184717378 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -