Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120882.seq
         (576 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g05670.1 68416.m00631 PHD finger family protein contains Pfam...    28   3.9  
At3g61830.1 68416.m06941 transcriptional factor B3 family protei...    28   5.1  
At5g06810.1 68418.m00770 mitochondrial transcription termination...    27   6.8  
At2g44410.1 68415.m05523 expressed protein                             27   6.8  

>At3g05670.1 68416.m00631 PHD finger family protein contains Pfam
           domain, PF00628: PHD-finger
          Length = 883

 Score = 28.3 bits (60), Expect = 3.9
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 66  CCSHIFCFSC 37
           CCSH FCF+C
Sbjct: 431 CCSHYFCFTC 440


>At3g61830.1 68416.m06941 transcriptional factor B3 family protein /
           auxin-responsive factor AUX/IAA-related contains Pfam
           profile: PF02309 AUX/IAA family
          Length = 602

 Score = 27.9 bits (59), Expect = 5.1
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = +2

Query: 62  QQVGAAAHFDRELIESYEERITQLEALCERQRRELAR--WFSKLSEPTSQSXLPG 220
           Q +      D  L++SY+E I +LE + E Q + LAR  W    ++      L G
Sbjct: 497 QGIAVGRAVDLTLLKSYDELIDELEEMFEIQGQLLARDKWIVVFTDDEGDMMLAG 551


>At5g06810.1 68418.m00770 mitochondrial transcription termination
           factor-related / mTERF-related contains Pfam profile
           PF02536: mTERF
          Length = 1141

 Score = 27.5 bits (58), Expect = 6.8
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = +3

Query: 162 NLPVGLASYLNRLLKVGFLVSWTI*NLXVSVASRSTISRRC 284
           ++ VGLA  +  L  +GF V W   NL   V+   +   RC
Sbjct: 789 DMNVGLAKVMEMLKAIGFGVDWVTENLSEEVSYDWSSMHRC 829


>At2g44410.1 68415.m05523 expressed protein 
          Length = 413

 Score = 27.5 bits (58), Expect = 6.8
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -1

Query: 69  TCCSHIFCFSC 37
           TCC H+FC+ C
Sbjct: 138 TCCGHLFCWGC 148


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,117,558
Number of Sequences: 28952
Number of extensions: 168122
Number of successful extensions: 588
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 575
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 588
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1121903184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)