BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120880.seq (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 27 0.68 CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 26 1.2 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 24 4.8 AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 23 6.4 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 6.4 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 23 8.4 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 26.6 bits (56), Expect = 0.68 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 94 CAIFL*-LDLRQSVFFVHKTRHVRAICQRMQKSNHRIAPRGSRARVEYFE 240 CA++ LDL+ S V + H C R + ++ P AR+ + E Sbjct: 6 CALYKQELDLQVSAKTVSRRLHAAGFCARRPRKVRKLLPHHVEARIRFAE 55 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 25.8 bits (54), Expect = 1.2 Identities = 24/99 (24%), Positives = 39/99 (39%), Gaps = 2/99 (2%) Frame = +2 Query: 14 CCTCCFGPITKTKVTVINENNLITQIFVQFFYNLICDKAYSLYTKRDMCVPFVKECKKAT 193 CC +TK N NN T++F + + + + +P K+C + Sbjct: 17 CCALPANTNAQTKQDSSNNNNRTTELFAYPAEQSAIESKQNARNRTPIFIP--KQCAENE 74 Query: 194 IGLRQEDHERVLSILNAQCNVSPPLL--TETDCCYRLKT 304 I L DHE + C+ P + ET CY++ T Sbjct: 75 I-LYPGDHEN-----DWVCDCKPTYVYHPETQQCYQMYT 107 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 562 HNPFLSLATLQISILINFIYELTD*CF 482 HN + L+ + IL+ IYE +D F Sbjct: 49 HNSNVVLSPFSVKILLTLIYEASDTSF 75 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 23.4 bits (48), Expect = 6.4 Identities = 18/78 (23%), Positives = 29/78 (37%), Gaps = 3/78 (3%) Frame = +1 Query: 172 QRMQKSNHRIAPRGSR---ARVEYFERAMQRFSTAANGNRLLLPFKNFMIKMGRNTNMKK 342 +RM+ +I P + + YF AM + N + P K +TN K Sbjct: 193 RRMELEKQKIRPTNKKFTGPTIRYFSTAMPIIEEVYDSNTEVDPLSISDPKEAEDTNDKT 252 Query: 343 VNKIASTVLIGFYLRHYL 396 K + G Y R ++ Sbjct: 253 SKKTTLMEVTGQYERTFI 270 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.4 bits (48), Expect = 6.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 112 VIEKLHKYLCNQIVFVNN 59 VI+ YL NQ+ F+NN Sbjct: 1006 VIQNGMNYLSNQLAFINN 1023 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 423 GSGVGTPQRLSFHHEQVFGRKH 488 GSG + QR FHH + H Sbjct: 15 GSGASSSQRSPFHHHHQQQQNH 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 727,676 Number of Sequences: 2352 Number of extensions: 14484 Number of successful extensions: 28 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -