BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120880.seq (654 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132952-14|CAB63386.1| 257|Caenorhabditis elegans Hypothetical... 28 5.0 AF099915-1|AAC68771.1| 460|Caenorhabditis elegans Hypothetical ... 28 5.0 >AL132952-14|CAB63386.1| 257|Caenorhabditis elegans Hypothetical protein Y51H4A.23 protein. Length = 257 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +2 Query: 110 NLICDKAYSLYTKRDMCVPFVKECKKATIGLRQEDHERVLSILNAQ 247 NL DK + + MC PF+K ++ I +R E+ LS + Q Sbjct: 69 NLNSDKKWYITYFEFMCNPFIKYMDESLISIRDVATEKFLSTMRDQ 114 >AF099915-1|AAC68771.1| 460|Caenorhabditis elegans Hypothetical protein E02H9.6 protein. Length = 460 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/73 (20%), Positives = 33/73 (45%) Frame = +2 Query: 35 PITKTKVTVINENNLITQIFVQFFYNLICDKAYSLYTKRDMCVPFVKECKKATIGLRQED 214 P + +IN NL ++ + YNL+C S+Y K+D + K + + + + Sbjct: 353 PTLLCAIPLINGINLQRTVYSKIIYNLLC----SIYHKKDKYLKETKNLELKNLNSKNFE 408 Query: 215 HERVLSILNAQCN 253 + ++ +C+ Sbjct: 409 NSKIKKNSELRCS 421 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,750,928 Number of Sequences: 27780 Number of extensions: 333194 Number of successful extensions: 924 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 924 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -