BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120878.seq (641 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0235 + 6122145-6122206,6122408-6122417,6123515-6123549,612... 28 5.5 >09_02_0235 + 6122145-6122206,6122408-6122417,6123515-6123549, 6124422-6124842,6124978-6125412 Length = 320 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 529 FVRVCRATNCVFST*PTPERIEVVLGDSII*QLQ 630 FV V ++TNC+ P PE I+ VL S+ L+ Sbjct: 219 FVPVLQSTNCLMEPLPIPEPIKEVLAISLFKPLE 252 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,290,436 Number of Sequences: 37544 Number of extensions: 337194 Number of successful extensions: 774 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -