BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120877.seq (647 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M89955-1|AAA35491.1| 377|Homo sapiens 5-HT1D-type serotonin rec... 33 1.2 M81589-1|AAA60315.1| 377|Homo sapiens serotonin 1D receptor pro... 33 1.2 BT007027-1|AAP35673.1| 377|Homo sapiens 5-hydroxytryptamine (se... 33 1.2 BC007720-1|AAH07720.1| 377|Homo sapiens 5-hydroxytryptamine (se... 33 1.2 AL049576-1|CAB81617.1| 377|Homo sapiens 5-hydroxytryptamine (se... 33 1.2 AF498979-1|AAM21126.1| 377|Homo sapiens 5-hydroxytryptamine rec... 33 1.2 >M89955-1|AAA35491.1| 377|Homo sapiens 5-HT1D-type serotonin receptor protein. Length = 377 Score = 32.7 bits (71), Expect = 1.2 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = -2 Query: 214 SSHSLNGSSTKMCAKPRTTVCLTCTLARILSCWSLC*RTLLKNLQVFSNICNTRRI 47 S+ SLN + T PRT L +LA +LS +L T+L N V + I TR++ Sbjct: 16 SNRSLNATETSEAWDPRTLQALKISLAVVLSVITLA--TVLSNAFVLTTILLTRKL 69 >M81589-1|AAA60315.1| 377|Homo sapiens serotonin 1D receptor protein. Length = 377 Score = 32.7 bits (71), Expect = 1.2 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = -2 Query: 214 SSHSLNGSSTKMCAKPRTTVCLTCTLARILSCWSLC*RTLLKNLQVFSNICNTRRI 47 S+ SLN + T PRT L +LA +LS +L T+L N V + I TR++ Sbjct: 16 SNRSLNATETSEAWDPRTLQALKISLAVVLSVITLA--TVLSNAFVLTTILLTRKL 69 >BT007027-1|AAP35673.1| 377|Homo sapiens 5-hydroxytryptamine (serotonin) receptor 1D protein. Length = 377 Score = 32.7 bits (71), Expect = 1.2 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = -2 Query: 214 SSHSLNGSSTKMCAKPRTTVCLTCTLARILSCWSLC*RTLLKNLQVFSNICNTRRI 47 S+ SLN + T PRT L +LA +LS +L T+L N V + I TR++ Sbjct: 16 SNRSLNATETSEAWDPRTLQALKISLAVVLSVITLA--TVLSNAFVLTTILLTRKL 69 >BC007720-1|AAH07720.1| 377|Homo sapiens 5-hydroxytryptamine (serotonin) receptor 1D protein. Length = 377 Score = 32.7 bits (71), Expect = 1.2 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = -2 Query: 214 SSHSLNGSSTKMCAKPRTTVCLTCTLARILSCWSLC*RTLLKNLQVFSNICNTRRI 47 S+ SLN + T PRT L +LA +LS +L T+L N V + I TR++ Sbjct: 16 SNRSLNATETSEAWDPRTLQALKISLAVVLSVITLA--TVLSNAFVLTTILLTRKL 69 >AL049576-1|CAB81617.1| 377|Homo sapiens 5-hydroxytryptamine (serotonin) receptor 1D protein. Length = 377 Score = 32.7 bits (71), Expect = 1.2 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = -2 Query: 214 SSHSLNGSSTKMCAKPRTTVCLTCTLARILSCWSLC*RTLLKNLQVFSNICNTRRI 47 S+ SLN + T PRT L +LA +LS +L T+L N V + I TR++ Sbjct: 16 SNRSLNATETSEAWDPRTLQALKISLAVVLSVITLA--TVLSNAFVLTTILLTRKL 69 >AF498979-1|AAM21126.1| 377|Homo sapiens 5-hydroxytryptamine receptor 1D protein. Length = 377 Score = 32.7 bits (71), Expect = 1.2 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = -2 Query: 214 SSHSLNGSSTKMCAKPRTTVCLTCTLARILSCWSLC*RTLLKNLQVFSNICNTRRI 47 S+ SLN + T PRT L +LA +LS +L T+L N V + I TR++ Sbjct: 16 SNRSLNATETSEAWDPRTLQALKISLAVVLSVITLA--TVLSNAFVLTTILLTRKL 69 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,415,373 Number of Sequences: 237096 Number of extensions: 1670206 Number of successful extensions: 3640 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3640 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7197658880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -