BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120874.seq (624 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0736 - 5600201-5600374,5600455-5600563,5601075-5601196,560... 27 9.2 >07_01_0736 - 5600201-5600374,5600455-5600563,5601075-5601196, 5602859-5602935,5603349-5603487,5604306-5604618, 5605084-5605394,5607245-5609141,5609239-5609374, 5609519-5609607,5610424-5610507,5611112-5611191, 5611312-5611446,5612340-5612585 Length = 1303 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 216 VGPRSSKSFNFILIYEVKHLILHYHFQYLNMKE 314 +G RS SF + L YE++H+ LHY +++ + Sbjct: 655 LGVRSLSSFQYEL-YEIQHVQLHYEVSCISIPQ 686 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,984,010 Number of Sequences: 37544 Number of extensions: 294984 Number of successful extensions: 651 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -