BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120874.seq (624 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38465| Best HMM Match : Nitrophorin (HMM E-Value=0.75) 73 3e-13 SB_52463| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_36117| Best HMM Match : Rubredoxin (HMM E-Value=1.8) 61 6e-10 SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) 60 1e-09 SB_37084| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_35802| Best HMM Match : Laminin_EGF (HMM E-Value=0.25) 57 1e-08 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_52361| Best HMM Match : EutS (HMM E-Value=1) 54 1e-07 SB_24133| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_10195| Best HMM Match : CXC (HMM E-Value=0.003) 51 9e-07 SB_49350| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49976| Best HMM Match : SEC-C (HMM E-Value=0.95) 49 3e-06 SB_21286| Best HMM Match : DUF352 (HMM E-Value=0.47) 48 5e-06 SB_49331| Best HMM Match : DUF352 (HMM E-Value=0.47) 48 5e-06 SB_48611| Best HMM Match : SKI (HMM E-Value=0.00037) 46 2e-05 SB_18737| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10893| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9251| Best HMM Match : Ribonuc_red_sm (HMM E-Value=0) 43 2e-04 SB_27444| Best HMM Match : Phage_integrase (HMM E-Value=0.0013) 41 0.001 SB_49670| Best HMM Match : TIR (HMM E-Value=1.2) 39 0.003 SB_48845| Best HMM Match : CheW (HMM E-Value=1.5) 38 0.005 SB_9577| Best HMM Match : Phage_tail_U (HMM E-Value=9.2) 38 0.009 SB_17898| Best HMM Match : Entericidin (HMM E-Value=4.3) 37 0.012 SB_17226| Best HMM Match : zf-UBR1 (HMM E-Value=5.8) 37 0.012 SB_10193| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_28042| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_56468| Best HMM Match : Bundlin (HMM E-Value=8.7) 37 0.015 SB_10274| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_26427| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_23936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_40157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_28799| Best HMM Match : SEC-C (HMM E-Value=0.95) 31 0.76 SB_50941| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_36671| Best HMM Match : IBB (HMM E-Value=2.8) 29 2.3 SB_28335| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_6643| Best HMM Match : Antimicrobial_8 (HMM E-Value=0.27) 28 7.1 SB_41184| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=10) 27 9.4 SB_25392| Best HMM Match : PHD (HMM E-Value=0.0062) 27 9.4 >SB_38465| Best HMM Match : Nitrophorin (HMM E-Value=0.75) Length = 1167 Score = 72.5 bits (170), Expect = 3e-13 Identities = 33/72 (45%), Positives = 48/72 (66%) Frame = -3 Query: 217 TAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDM 38 TA L + Y M+ + ++ ++AER G+W HL V +MLPYF +SGH Y KSA++YLQ M Sbjct: 705 TAVLRLSYMRMIDILQKSIKAERTGNWDLHLQSVLDMLPYFAASGHKLYEKSAYIYLQKM 764 Query: 37 MQLQDSMDPEVY 2 +L ++ P VY Sbjct: 765 REL-EAKHPSVY 775 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = -3 Query: 622 ISPPPDGSEVSKIIVRLGGFHLLMSYLGAIGYIMQGSG*K 503 I P+ SE+ I++RLG HL MS+LG+IG++M GSG K Sbjct: 483 IENEPEDSELRPIVLRLGALHLHMSFLGSIGHLMAGSGLK 522 >SB_52463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 61.3 bits (142), Expect = 6e-10 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 1/76 (1%) Frame = -3 Query: 247 KLKDFEERGPTAQLWIQYF-NMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPY 71 +L D T++LW+ F V + +++AER GDW HL VK+MLPYF +S H Y Sbjct: 586 RLDDVASLSKTSKLWVDCFIKPVFIMMLYVQAEREGDWPLHLVAVKKMLPYFFASAHVNY 645 Query: 70 AKSAHLYLQDMMQLQD 23 + YL+ M +L D Sbjct: 646 ERWGLYYLRSMERLGD 661 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = -3 Query: 562 HLLMSYLGAIGYIMQGSG 509 ++LMS+ GA+G +MQGSG Sbjct: 515 NMLMSFFGAVGILMQGSG 532 >SB_36117| Best HMM Match : Rubredoxin (HMM E-Value=1.8) Length = 996 Score = 61.3 bits (142), Expect = 6e-10 Identities = 29/68 (42%), Positives = 39/68 (57%) Frame = -3 Query: 205 WIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQLQ 26 W Y +VSL +RAER G W+ HL+ V EM PYF+S Y++ +Y+ DM L Sbjct: 545 WNNYIEVVSLLLRLIRAEREGSWELHLTSVNEMFPYFYSMDRINYSRWLPVYVADMRML- 603 Query: 25 DSMDPEVY 2 S PEV+ Sbjct: 604 PSTAPEVH 611 >SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) Length = 1487 Score = 60.1 bits (139), Expect = 1e-09 Identities = 24/64 (37%), Positives = 40/64 (62%) Frame = -3 Query: 217 TAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDM 38 T W++Y +MV L +F++AER G+W+ HL+ M+P+F S Y++ +Y+ DM Sbjct: 379 TFDFWMRYMSMVKLLLQFIKAERTGNWELHLALTAAMIPHFFSMDRPNYSRWLPVYISDM 438 Query: 37 MQLQ 26 QL+ Sbjct: 439 RQLE 442 >SB_37084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 57.6 bits (133), Expect = 8e-09 Identities = 28/65 (43%), Positives = 38/65 (58%) Frame = -3 Query: 196 YFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQLQDSM 17 Y VSL F+RAER G W+ H + V EM+PYF+S Y++ +Y+ DM L S Sbjct: 733 YIEAVSLLLRFIRAEREGSWELHRTSVNEMIPYFYSIDRINYSRWLPVYVADMRML-PST 791 Query: 16 DPEVY 2 PEV+ Sbjct: 792 APEVH 796 Score = 33.9 bits (74), Expect = 0.11 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 Query: 583 IVRLGGFHLLMSYLGAIGYIMQGSG 509 ++R+GGFH+ ++L IG I Q SG Sbjct: 602 VIRMGGFHIAFNFLAVIGKIFQDSG 626 >SB_35802| Best HMM Match : Laminin_EGF (HMM E-Value=0.25) Length = 781 Score = 56.8 bits (131), Expect = 1e-08 Identities = 23/64 (35%), Positives = 39/64 (60%) Frame = -3 Query: 217 TAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDM 38 T W++Y +MV L +F++AER G+W+ HL+ M+ +F S Y++ +Y+ DM Sbjct: 242 TFDFWMRYMSMVKLLLQFIKAERTGNWELHLASTAAMISHFFSMDRPNYSRWLPVYISDM 301 Query: 37 MQLQ 26 QL+ Sbjct: 302 RQLE 305 >SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1593 Score = 55.2 bits (127), Expect = 4e-08 Identities = 27/77 (35%), Positives = 43/77 (55%) Frame = -3 Query: 232 EERGPTAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHL 53 +E+ P ++ QY MV F+RA R G+W HL ++ YF + YA+ + Sbjct: 1223 KEKYPLFKVVRQYMRMVMEMMTFIRAVRTGNWALHLEALEVFTTYFFAHDMLNYARMIPV 1282 Query: 52 YLQDMMQLQDSMDPEVY 2 YL +M +L++S DPE+Y Sbjct: 1283 YLAEMSRLEES-DPEIY 1298 >SB_52361| Best HMM Match : EutS (HMM E-Value=1) Length = 682 Score = 53.6 bits (123), Expect = 1e-07 Identities = 26/77 (33%), Positives = 43/77 (55%) Frame = -3 Query: 232 EERGPTAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHL 53 +E+ P ++ QY MV F+RA R G+W HL ++ YF + YA+ + Sbjct: 482 KEKYPLFKVVRQYMRMVMEMMTFIRAVRTGNWALHLEALEVFTKYFSAHDMLNYARMIPV 541 Query: 52 YLQDMMQLQDSMDPEVY 2 +L +M +L++S DPE+Y Sbjct: 542 FLAEMSRLEES-DPEIY 557 >SB_24133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/75 (33%), Positives = 41/75 (54%) Frame = -3 Query: 232 EERGPTAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHL 53 +E A+ W+ Y ++ L L A R G W+ +LSC++E++P+ + YA+ Sbjct: 206 KEGSDLAKFWLSYQDLCELLFNLLYATRTGGWELYLSCIEEVIPWAFAYDRQNYARYLVP 265 Query: 52 YLQDMMQLQDSMDPE 8 YL DM L ++M PE Sbjct: 266 YLDDMRSLPETM-PE 279 >SB_10195| Best HMM Match : CXC (HMM E-Value=0.003) Length = 1365 Score = 50.8 bits (116), Expect = 9e-07 Identities = 24/66 (36%), Positives = 36/66 (54%) Frame = -3 Query: 199 QYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQLQDS 20 QY MV F+RA R G+W HL ++ YF + YA+ +YL + +L++S Sbjct: 660 QYMGMVMEMMTFIRAVRTGNWALHLEALEVFTKYFFAHDMLNYARMIPVYLAEKSRLEES 719 Query: 19 MDPEVY 2 DPE+Y Sbjct: 720 -DPEIY 724 >SB_49350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 998 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/67 (35%), Positives = 38/67 (56%) Frame = -3 Query: 202 IQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQLQD 23 ++ MV F+RA R GDWK HL+ ++ + YF + YA+ LYL + MQ+ + Sbjct: 450 LKLLRMVMEMLLFVRAVRTGDWKLHLTSLELLTKYFFAHDRLNYARMVPLYLPE-MQMLE 508 Query: 22 SMDPEVY 2 + DP +Y Sbjct: 509 ATDPAIY 515 >SB_49976| Best HMM Match : SEC-C (HMM E-Value=0.95) Length = 1037 Score = 49.2 bits (112), Expect = 3e-06 Identities = 18/43 (41%), Positives = 29/43 (67%) Frame = -3 Query: 217 TAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHS 89 T W++Y +MV L +F++AER G+W+ HL+ M+P+F S Sbjct: 678 TFDFWMRYMSMVKLLLQFIKAERTGNWELHLASTAAMIPHFFS 720 Score = 31.1 bits (67), Expect = 0.76 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 598 EVSKIIVRLGGFHLLMSYLGAIGYIMQGSG 509 E + ++RLGGFH+ +++L +G SG Sbjct: 538 EFANTVIRLGGFHIALNFLSLLGKKFASSG 567 >SB_21286| Best HMM Match : DUF352 (HMM E-Value=0.47) Length = 690 Score = 48.4 bits (110), Expect = 5e-06 Identities = 26/68 (38%), Positives = 39/68 (57%) Frame = -3 Query: 208 LWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQL 29 L+ QY MV + LRA R G+W+ HLSCV++M+ + + YA+ YL +M L Sbjct: 482 LFKQYM-MVEILLGLLRASREGNWELHLSCVRDMISLCFAYDNINYARYLSAYLSEMSHL 540 Query: 28 QDSMDPEV 5 D+ P+V Sbjct: 541 -DTEHPDV 547 >SB_49331| Best HMM Match : DUF352 (HMM E-Value=0.47) Length = 586 Score = 48.4 bits (110), Expect = 5e-06 Identities = 26/68 (38%), Positives = 39/68 (57%) Frame = -3 Query: 208 LWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQL 29 L+ QY MV + LRA R G+W+ HLSCV++M+ + + YA+ YL +M L Sbjct: 482 LFKQYM-MVEILLGLLRASREGNWELHLSCVRDMISLCFAYDNINYARYLSAYLSEMSHL 540 Query: 28 QDSMDPEV 5 D+ P+V Sbjct: 541 -DTEHPDV 547 >SB_48611| Best HMM Match : SKI (HMM E-Value=0.00037) Length = 926 Score = 46.0 bits (104), Expect = 2e-05 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = -3 Query: 166 FLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQLQDSMDPEVY 2 F+RA R G+W HL ++ YF + YA+ ++L +M +L++S DPE+Y Sbjct: 3 FIRAVRTGNWALHLEALEVFTKYFSAHDMLNYARMIPVFLAEMSRLEES-DPEIY 56 >SB_18737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 3/71 (4%) Frame = -3 Query: 211 QLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDM-- 38 + W Y + V L F+RAER G W HL+ V EM P+F Y+ + Sbjct: 140 RFWDLYIDAVMLLLCFIRAEREGSWNLHLNAVAEMAPFFFCMDRINYSSEIQCTFSQVWT 199 Query: 37 -MQLQDSMDPE 8 M L+ S++ E Sbjct: 200 DMALEQSVNRE 210 Score = 32.7 bits (71), Expect = 0.25 Identities = 11/25 (44%), Positives = 20/25 (80%) Frame = -3 Query: 586 IIVRLGGFHLLMSYLGAIGYIMQGS 512 +I+R+GGFH+ ++++ AIG + Q S Sbjct: 1 MIIRMGGFHIALNFIAAIGKMFQDS 25 >SB_10893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/69 (28%), Positives = 38/69 (55%) Frame = -3 Query: 211 QLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQ 32 Q W Y + L F+R+ R+ D+ + + +MLP+F + H Y++ ++++DM + Sbjct: 34 QYWYTYLQLELLLLVFVRSVRLDDFDMYRDALYKMLPWFFALNHTHYSRWLRVHVKDMCE 93 Query: 31 LQDSMDPEV 5 L D P+V Sbjct: 94 L-DMKAPDV 101 >SB_9251| Best HMM Match : Ribonuc_red_sm (HMM E-Value=0) Length = 928 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = -3 Query: 205 WIQYFNMVS-LAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQL 29 W+ Y + V + LRA R G+WK HL ++ ++P+ + YA+ Y M +L Sbjct: 770 WMSYIDFVEGIILGLLRASREGNWKLHLMAIRNLIPWCFAYDRVNYARYLTPYFAQMTRL 829 Query: 28 QDSMDPEV 5 ++ PEV Sbjct: 830 KED-HPEV 836 >SB_27444| Best HMM Match : Phage_integrase (HMM E-Value=0.0013) Length = 940 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = -3 Query: 607 DGSEVSKIIVRLGGFHLLMSYLGAIGYIMQGSG 509 + SE+ +I++RLG HL MS+LG+I ++M GSG Sbjct: 676 EDSELRQIVLRLGALHLHMSFLGSICHLMAGSG 708 >SB_49670| Best HMM Match : TIR (HMM E-Value=1.2) Length = 512 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/68 (26%), Positives = 35/68 (51%) Frame = -3 Query: 220 PTAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQD 41 PT + W + L +RA+R ++ ++ ++E++P F H YAK ++++D Sbjct: 384 PTFRFWNAILHYQMLVLLVVRAQRQRNFVLYVEALEELVPLFFVLDHVNYAKWTSIHIRD 443 Query: 40 MMQLQDSM 17 M L S+ Sbjct: 444 MKSLPQSI 451 >SB_48845| Best HMM Match : CheW (HMM E-Value=1.5) Length = 368 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/68 (25%), Positives = 36/68 (52%) Frame = -3 Query: 220 PTAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQD 41 PT + W + L +RA+R ++ ++ ++E++P F H YA+ ++++D Sbjct: 5 PTFRFWNAILHYQMLVLLVVRAQRQRNFVLYVEALEELVPLFFVLDHVNYARWTPIHIRD 64 Query: 40 MMQLQDSM 17 M+ L S+ Sbjct: 65 MISLPQSI 72 >SB_9577| Best HMM Match : Phage_tail_U (HMM E-Value=9.2) Length = 217 Score = 37.5 bits (83), Expect = 0.009 Identities = 17/68 (25%), Positives = 35/68 (51%) Frame = -3 Query: 220 PTAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQD 41 PT + W + L +RA+R ++ ++ ++E++P F H YA+ ++++D Sbjct: 89 PTFRFWNAILHYQMLVLLVVRAQRQRNFVLYVEALEELVPLFFVLDHVNYARWTPIHIRD 148 Query: 40 MMQLQDSM 17 M L S+ Sbjct: 149 MKSLPQSI 156 >SB_17898| Best HMM Match : Entericidin (HMM E-Value=4.3) Length = 532 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/26 (61%), Positives = 21/26 (80%) Frame = -3 Query: 586 IIVRLGGFHLLMSYLGAIGYIMQGSG 509 +IVRLG H+LMS++ AIG +MQ SG Sbjct: 126 VIVRLGVMHMLMSFVDAIGTLMQDSG 151 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 112 EMLPYFHSSGHFPYAKSAHLYLQDM 38 E++PYF +S H YA+ YL+ M Sbjct: 176 EIMPYFFASSHVNYARYGLYYLRSM 200 >SB_17226| Best HMM Match : zf-UBR1 (HMM E-Value=5.8) Length = 308 Score = 37.1 bits (82), Expect = 0.012 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Frame = -3 Query: 256 INMKLKDFEERG---PTAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHS 89 I KL +F++ P Q++ QY MV F+RA R DW HL +++ Y+ S Sbjct: 104 IMSKLDEFDKEHANTPMFQVFYQYKTMVLEMMMFVRAVRTADWLLHLQAIEKFTKYYFS 162 >SB_10193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 37.1 bits (82), Expect = 0.012 Identities = 17/68 (25%), Positives = 35/68 (51%) Frame = -3 Query: 220 PTAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQD 41 PT + W + L +RA+R ++ ++ ++E++P F H YA+ ++++D Sbjct: 234 PTFRFWNVILHYQMLVLLVVRAQRQRNFVLYVEALEELVPLFFVLDHVNYARWTPIHIRD 293 Query: 40 MMQLQDSM 17 M L S+ Sbjct: 294 MKSLPQSI 301 >SB_28042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/26 (61%), Positives = 21/26 (80%) Frame = -3 Query: 586 IIVRLGGFHLLMSYLGAIGYIMQGSG 509 +IVRLG H+LMS++ AIG +MQ SG Sbjct: 106 VIVRLGLMHMLMSFVDAIGTLMQDSG 131 >SB_56468| Best HMM Match : Bundlin (HMM E-Value=8.7) Length = 496 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/68 (25%), Positives = 34/68 (50%) Frame = -3 Query: 220 PTAQLWIQYFNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQD 41 PT + W + L +RA+R ++ ++ ++E++P F H YA+ ++ +D Sbjct: 368 PTFRFWNAILHYQMLVLLVVRAQRQRNFVLYVEALEELVPLFFVLDHVNYARWTPIHFRD 427 Query: 40 MMQLQDSM 17 M L S+ Sbjct: 428 MKSLPQSI 435 >SB_10274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 844 Score = 35.5 bits (78), Expect = 0.035 Identities = 16/56 (28%), Positives = 31/56 (55%) Frame = -3 Query: 193 FNMVSLAKEFLRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQLQ 26 F+ + LA +R+ R DW HL+ +++M+P+ + + YA+ Y +M L+ Sbjct: 564 FHEILLA--LVRSSRESDWALHLTAIRDMIPWCFAYDNVNYARYLSSYPSEMSHLE 617 >SB_26427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 34.7 bits (76), Expect = 0.062 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = -3 Query: 130 HLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQLQDSMDPEVY 2 HL V +MLPY +S + Y SA LY Q M L+ P+VY Sbjct: 2 HLQVVSQMLPYLAASENNHYTWSASLYQQSMKNLRVDR-PDVY 43 >SB_23936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.5 bits (73), Expect = 0.14 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 598 EVSKIIVRLGGFHLLMSYLGAIGYIMQGSG 509 E++ ++RLGGFH+ ++ L +G GSG Sbjct: 36 EIANTVIRLGGFHIALNVLSLLGKKFAGSG 65 >SB_40157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 31.1 bits (67), Expect = 0.76 Identities = 12/49 (24%), Positives = 29/49 (59%) Frame = -3 Query: 163 LRAERMGDWKAHLSCVKEMLPYFHSSGHFPYAKSAHLYLQDMMQLQDSM 17 +RA+R ++ ++ +++++P F H YA+ ++++DM L S+ Sbjct: 28 VRAQRQRNFVLYVEALEKLVPLFFVLDHVNYARWTPIHIRDMKSLPQSI 76 >SB_28799| Best HMM Match : SEC-C (HMM E-Value=0.95) Length = 710 Score = 31.1 bits (67), Expect = 0.76 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 598 EVSKIIVRLGGFHLLMSYLGAIGYIMQGSG 509 E + ++RLGGFH+ +++L +G SG Sbjct: 549 EFANTVIRLGGFHIALNFLSLLGKKFASSG 578 >SB_50941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 265 TS*INMKLKDFEERGPTA--QLWIQYFNMVSLAKEFLRAERMGDWKAHLS 122 T ++ L+ F+E + + W MV L +F+ A+R G+W+ HL+ Sbjct: 264 TQDVDTLLRRFKESKSSKLFRFWDDNIKMVLLLLKFISAKRKGNWQLHLA 313 >SB_36671| Best HMM Match : IBB (HMM E-Value=2.8) Length = 1080 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 598 EVSKIIVRLGGFHLLMSYLGAIGYIMQGSG 509 E + ++R GGFH+ +++L +G SG Sbjct: 612 EFANTVIRFGGFHIALNFLSLLGKKFASSG 641 >SB_28335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1051 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 157 AERMGDWKAHLSC-VKEMLPYFHSSGHFPY 71 AE++ WK +KE P F+ +G FPY Sbjct: 93 AEKIRKWKTSTELEIKEKFPQFNKNGIFPY 122 >SB_6643| Best HMM Match : Antimicrobial_8 (HMM E-Value=0.27) Length = 251 Score = 27.9 bits (59), Expect = 7.1 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = +3 Query: 243 NFILIYEVKHLILHYHFQYLNMKECYLIY 329 + I++YE +H + YH++ L++ ++Y Sbjct: 156 HLIIVYERRHAVSGYHYKSLSVTHLIIVY 184 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/35 (25%), Positives = 20/35 (57%) Frame = +3 Query: 225 RSSKSFNFILIYEVKHLILHYHFQYLNMKECYLIY 329 +S + I++YE +H + YH++ L++ +Y Sbjct: 81 KSLSVIHLIIVYERRHAVSGYHYESLSVTHLIRVY 115 >SB_41184| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=10) Length = 252 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 575 TWRISSTHVLSRSNWLYYAR*RVKEVLSEI 486 TW+IS TH S W + ++K SE+ Sbjct: 121 TWQISRTHFRHTSTWFPQVKSKLKPQFSEV 150 >SB_25392| Best HMM Match : PHD (HMM E-Value=0.0062) Length = 485 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 242 QFHINL*SKAPDTSLSFSISEYERVLSNIW 331 +FH+NL S P+ +L S Y +++S+ W Sbjct: 65 KFHLNLLSTHPERTLRVSKDVYRKLVSSDW 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,467,591 Number of Sequences: 59808 Number of extensions: 343244 Number of successful extensions: 907 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 907 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -