BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120873.seq (625 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 0.90 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 4.8 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 24.2 bits (50), Expect = 0.90 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +1 Query: 130 RFTHILRYQNALSKSCY 180 R+T +L + + LSK+CY Sbjct: 58 RYTFLLEWYHTLSKACY 74 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.8 bits (44), Expect = 4.8 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 Query: 128 IGLLIYSDIKMH*ASLAIGNNSQEYIKGSHN*FDYVFTT 244 I LI D+K+ SL I +Q H YVF T Sbjct: 106 INKLIEFDVKLQNVSLIINYENQRTRSRIHLFVRYVFVT 144 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,637 Number of Sequences: 336 Number of extensions: 3100 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -