BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120869.seq (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 29 3.3 At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:100... 28 4.4 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 103 CKRRPHNIDGRQVDCGRRHLQQRSHGVQ 20 C+ H IDGR V+C +L R H Q Sbjct: 67 CENPNHTIDGRTVNCKLAYLGARVHNYQ 94 >At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:1000090) [Gossypium barbadense] Length = 335 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 379 ENYAVSNCKFNIEDYNNIFKVMENIRKHSNKNLNDQDELNIY 504 ENYA N + N +K EN+++ S N+ ++ N+Y Sbjct: 174 ENYAKEEFNNNNNNNNYNYKYDENVKEESFPENNEDNKKNVY 215 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,095,118 Number of Sequences: 28952 Number of extensions: 256862 Number of successful extensions: 837 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 837 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -