BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120867.seq (629 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1169 - 35082160-35082292,35082572-35082651,35082727-350829... 28 5.3 02_02_0151 - 7220335-7220819,7220933-7223507 27 9.3 >01_06_1169 - 35082160-35082292,35082572-35082651,35082727-35082939, 35083243-35083323,35083381-35083492,35083697-35083786, 35083986-35084176,35084683-35084762,35085266-35085347, 35085506-35085590,35086261-35086379 Length = 421 Score = 28.3 bits (60), Expect = 5.3 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 7/52 (13%) Frame = +2 Query: 161 CRDVKMLKTNM-AIVNYMGNCNTCQADMRV------ALTTCFAICGIWTMKI 295 C D + N+ + + + C+A V AL + FAICGIW +KI Sbjct: 43 CHDENSVYANLLSNIGFNTGLEVCKASYTVSLAYGGALKSDFAICGIWFLKI 94 >02_02_0151 - 7220335-7220819,7220933-7223507 Length = 1019 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 395 GRDPDTVDRHGLHFKLCNMSETLFLFTYKASVIKFSSSK 279 GR PD +DR L + N+S F +++ +FS K Sbjct: 124 GRLPDRIDRLSLGMQHLNLSSNAFTGDVPSAIARFSKLK 162 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,289,252 Number of Sequences: 37544 Number of extensions: 284700 Number of successful extensions: 797 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 797 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1537558360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -