BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120864.seq (559 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT025233-1|ABF17924.1| 818|Drosophila melanogaster FI01002p pro... 29 5.6 AF289994-1|AAG02459.1| 818|Drosophila melanogaster thyroid horm... 29 5.6 AE013599-3354|AAF46815.2| 818|Drosophila melanogaster CG5465-PA... 29 5.6 >BT025233-1|ABF17924.1| 818|Drosophila melanogaster FI01002p protein. Length = 818 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 45 LLTYIDQEPNEKGRMIITYATMISKKILLPR 137 LLT + Q P E M++ +++SK++L+P+ Sbjct: 681 LLTRLAQNPAEPDEMLLDECSLLSKQLLIPQ 711 >AF289994-1|AAG02459.1| 818|Drosophila melanogaster thyroid hormone receptor-associatedprotein TRAP95 protein. Length = 818 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 45 LLTYIDQEPNEKGRMIITYATMISKKILLPR 137 LLT + Q P E M++ +++SK++L+P+ Sbjct: 681 LLTRLAQNPAEPDEMLLDECSLLSKQLLIPQ 711 >AE013599-3354|AAF46815.2| 818|Drosophila melanogaster CG5465-PA protein. Length = 818 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 45 LLTYIDQEPNEKGRMIITYATMISKKILLPR 137 LLT + Q P E M++ +++SK++L+P+ Sbjct: 681 LLTRLAQNPAEPDEMLLDECSLLSKQLLIPQ 711 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,837,519 Number of Sequences: 53049 Number of extensions: 344730 Number of successful extensions: 442 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2151905496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -