BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120862.seq (632 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16838| Best HMM Match : TolA (HMM E-Value=2) 31 1.0 SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) 30 1.4 SB_47272| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 30 1.8 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 30 1.8 SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_41351| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 29 3.1 SB_15073| Best HMM Match : MED7 (HMM E-Value=2.1) 29 3.1 SB_39538| Best HMM Match : VWA (HMM E-Value=0) 29 4.1 SB_38320| Best HMM Match : SSDP (HMM E-Value=0.34) 29 4.1 SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) 29 4.1 SB_59142| Best HMM Match : RVT_1 (HMM E-Value=2.5e-09) 28 5.5 SB_52004| Best HMM Match : rve (HMM E-Value=1.2e-16) 28 5.5 SB_43735| Best HMM Match : PHD (HMM E-Value=5.6e-06) 28 5.5 SB_41742| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_39020| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_34336| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_32984| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_28158| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27) 28 5.5 SB_21933| Best HMM Match : RVT_1 (HMM E-Value=9.1e-27) 28 5.5 SB_20467| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_6246| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_3510| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_1807| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_54014| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_51857| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 28 5.5 SB_45059| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_41413| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_27583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_25888| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_19509| Best HMM Match : rve (HMM E-Value=5.4e-26) 28 5.5 SB_16379| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_11418| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.5 SB_10464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 28 5.5 SB_4571| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_3197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 28 7.2 SB_33431| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 7.2 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 28 7.2 SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 28 7.2 SB_6709| Best HMM Match : PCNA_C (HMM E-Value=9.8) 28 7.2 SB_6122| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-26) 28 7.2 SB_47409| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-17) 27 9.6 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 27 9.6 SB_51678| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 27 9.6 SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_21529| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 27 9.6 >SB_16838| Best HMM Match : TolA (HMM E-Value=2) Length = 371 Score = 30.7 bits (66), Expect = 1.0 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 81 SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQ-HKLGSDRTVQQEQRTDARRRR 248 S N + Q+ QQ+ R YD +QQ + QQQ + + QQEQ+ ++RR Sbjct: 32 SNNVQLQQQKRQQQQKRTYN-YDIQQQQKRQQQQQKRQQQKQKRQQQEQKLQQQQRR 87 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 117 QQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRR 248 QQ+ R + +QQ QQ+ KL + QQ+Q+ ++RR Sbjct: 56 QQQKRQQQQQKRQQQKQKRQQQEQKLQQQQRRQQQQKRQPQQRR 99 >SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) Length = 575 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 7 EKSMTDERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRD-NKMDTSRSN 183 E + +ERG ++ +PS P TA FTN + V P +R+ N++ SRS+ Sbjct: 506 EARVPEERGYGHFIKTRTGDPHPSYPLTASFTNYPLLSTLDPLVAPLSRELNQLPASRSH 565 >SB_47272| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 737 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAESLPSDSNIFRHRLC*IRCRRTRK 554 DT+ +VN V +FES++ I++ R K+ GQG ++ ++ LC R + RK Sbjct: 430 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDNC-GYQHMANQELCPARGKDCRK 486 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 93 HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSD-RTVQQEQRTDARRRRI 251 H H R+ +R R + A+ GH ++ K +D T+++ DAR+ I Sbjct: 651 HHHHRSKKDRRHRNTKTHHAKHLKGHSARKHRKENNDAETLEEAVEKDARKNDI 704 >SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 43 YNTPPPPLRYPSNPATAIFTNAQ 111 YNT PPPL +P++P ++ Q Sbjct: 58 YNTYPPPLSHPNDPTRGFYSPVQ 80 >SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1146 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +3 Query: 102 QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 245 Q QQ + +D +QQ H+ QQQH QQ+QR D +++ Sbjct: 1078 QHDQQQQNTGQQQQHDKQQQ--HDQQQQHDQQQQHDQQQQQRHDQQQQ 1123 Score = 28.3 bits (60), Expect = 5.5 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +3 Query: 45 QHPSAAAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQH-KLGSDRTVQQE 221 QHPS E H Q+ N Q+ + QQ H+ QQQH + R QQ+ Sbjct: 1064 QHPSEQ-ETDHEQPAQHDQQQQNTGQQQQHDKQQQHDQQQQHDQQQQHDQQQQQRHDQQQ 1122 Query: 222 QRTDARRRR 248 Q D ++++ Sbjct: 1123 QHHDQQQQQ 1131 >SB_41351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +3 Query: 177 QQQHKLGSDRTVQQEQRTDARRRRIYWYNKCV--DFVQKIIRYYRCNDMSE 323 QQ H+L D VQ+ Q+ R + Y ++C D + +Y C+D E Sbjct: 50 QQTHELPCDDAVQEAQQEARREKNEYLKSRCAESDDQDESEKYEYCDDEEE 100 >SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 917 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 55 PPPLRYPSN-PATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNS 195 PP R+PS P+ NA + +N P Y P D+ D S + +S Sbjct: 550 PPEYRFPSEEPSPYAEENAISRSNPPVYTPKEEDDDDDDDEESETEDS 597 >SB_15073| Best HMM Match : MED7 (HMM E-Value=2.1) Length = 644 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +3 Query: 177 QQQHKLGSDRTVQQEQRTDARRRRIYWYNKCV--DFVQKIIRYYRCNDMSE 323 QQ H+L D VQ+ Q+ R + Y ++C D + +Y C+D E Sbjct: 574 QQTHELPCDDAVQEAQQEARREKNEYLKSRCAESDDQDESEKYEYCDDEEE 624 >SB_39538| Best HMM Match : VWA (HMM E-Value=0) Length = 3208 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/54 (24%), Positives = 29/54 (53%) Frame = +3 Query: 81 SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARR 242 S N H+ R ++++R+R +A + +P+++ +L R + ++T RR Sbjct: 3012 SRNDHVQSRFGAREKSRIRRGIEAILRGRTKPRRRRRLNKSRR-RTHKKTTLRR 3064 >SB_38320| Best HMM Match : SSDP (HMM E-Value=0.34) Length = 273 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +3 Query: 102 QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRI 251 Q+ QQ+ + + +QQ + QQQ + + Q +QRTD ++ I Sbjct: 31 QQQQKQQQQQQQQQQKQQQQKQQQQQQQQQQQQQQQQQHQQRTDKKQTEI 80 >SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) Length = 592 Score = 28.7 bits (61), Expect = 4.1 Identities = 17/65 (26%), Positives = 33/65 (50%) Frame = +1 Query: 7 EKSMTDERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNS 186 EK + E+ + +P P +R S I+T + T + Y + R +++ TS+ +S Sbjct: 211 EKIESSEKFSEKSESPEPSVRVDSETGDEIYTVSATPSETESYATTSMR-SRVSTSKGSS 269 Query: 187 TNSVA 201 + SV+ Sbjct: 270 SPSVS 274 >SB_59142| Best HMM Match : RVT_1 (HMM E-Value=2.5e-09) Length = 772 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_52004| Best HMM Match : rve (HMM E-Value=1.2e-16) Length = 869 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_43735| Best HMM Match : PHD (HMM E-Value=5.6e-06) Length = 772 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_41742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1061 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_39020| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 319 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 126 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 161 >SB_34336| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 374 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_32984| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 361 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_28158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = +1 Query: 73 PSNPATAIFTNA-QTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTLDAGE 249 P++ T F N+ + N + P + RDN +DTS ++ + + NK++ + GE Sbjct: 132 PNDNNTLSFDNSFNPFRNKSTWTPSSGRDNSLDTSPNSVKLQIQNSTLNKTRS-NITPGE 190 Query: 250 SIGTTNV 270 T + Sbjct: 191 RNALTQL 197 >SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27) Length = 1036 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_21933| Best HMM Match : RVT_1 (HMM E-Value=9.1e-27) Length = 510 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_20467| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 317 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_6246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 5.5 Identities = 18/84 (21%), Positives = 44/84 (52%), Gaps = 3/84 (3%) Frame = +3 Query: 171 EPQQQHKLGSDRTVQQEQRTDARRRRIYWYNKCVDFVQKIIRYYRCN-DMSELSPLMI-- 341 E +HK+ ++ +++ + D RRRI N ++ ++K + R + +++L L++ Sbjct: 48 EESSKHKITAEARLRRLRANDRERRRIQSINVALEALRKAVPNTRSSGKLTKLDTLLLAR 107 Query: 342 HFINTIRDMCIDTNPINVNVVKRF 413 +I + ++ T N++ K+F Sbjct: 108 DYIKHLNEILQRTRDENLDRNKKF 131 >SB_3510| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 272 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 130 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 165 >SB_1807| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 281 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_54014| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 176 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_51857| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 438 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 130 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 165 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_45059| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 519 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_41413| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 471 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 160 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 195 >SB_27583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_25888| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 606 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 28.3 bits (60), Expect = 5.5 Identities = 18/73 (24%), Positives = 28/73 (38%), Gaps = 1/73 (1%) Frame = +3 Query: 249 IYWYNKCVDFVQKIIRYYRCNDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESE-E 425 I W CV V DM LSP ++ + C + + ++RF E Sbjct: 896 IEWLEMCVVHVSTFTAELSITDMHSLSPSVLKVAKYAYEHCQQSEVLYGTFLQRFSEELS 955 Query: 426 TMIRHLIRLQKEL 464 + + +LQK L Sbjct: 956 AIFKKAYQLQKAL 968 >SB_19509| Best HMM Match : rve (HMM E-Value=5.4e-26) Length = 1195 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 130 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 165 >SB_16379| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 499 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 77 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 112 >SB_11418| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 292 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 80 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 115 >SB_10464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 960 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_4571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 635 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 670 >SB_3197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1246 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/52 (23%), Positives = 25/52 (48%) Frame = +3 Query: 93 HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRR 248 H QR ++ + A +QQ + QQQ + + QQ+Q+ ++++ Sbjct: 112 HDDQRTEYDEKTNILAPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 163 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +1 Query: 31 GNFYYNTPPPPLRYPSNPATAIF-TNAQTYNNAPGYVPPTTRDNKMD 168 G + PPP L++ N + A+F ++ N++ + P ++R D Sbjct: 268 GRYQRKGPPPRLKFSRNSSPALFPASSMCENSSLSFYPASSRGGSPD 314 >SB_33431| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 377 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETGVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 27.9 bits (59), Expect = 7.2 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +1 Query: 49 TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 228 +P P PS+P+ + + + + +PGY P + S S S S + +P + S Sbjct: 413 SPSSPAFMPSSPSMSPASPSYS-PTSPGYSPSSPSSGYSPASPSYSPTSPSYSPTSPSYS 471 Query: 229 PT 234 PT Sbjct: 472 PT 473 >SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 922 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 488 DT+ VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETGVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_6709| Best HMM Match : PCNA_C (HMM E-Value=9.8) Length = 279 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +1 Query: 58 PPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNK 219 PP + +P + N +++ P Y PP D + T RS S +V A Y + Sbjct: 144 PPSSHSRSPNSPGSPNPTLFSH-PSYYPPPPLDFQAGTKRSASCMAVVEADYGR 196 >SB_6122| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-26) Length = 363 Score = 27.9 bits (59), Expect = 7.2 Identities = 9/40 (22%), Positives = 21/40 (52%) Frame = +1 Query: 505 IFSGIVCAKFAAGVRAKILQRWALICWVKTLWAEAAKQLQ 624 + + ++C F G+R + Q C++ + W E +K ++ Sbjct: 305 VINPLICFMFTEGLRKALKQMLTCGCFLNSTWIEPSKTME 344 >SB_47409| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-17) Length = 1571 Score = 27.5 bits (58), Expect = 9.6 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 112 TYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAP--YNKSKEPTLDA 243 TY NA + TSR N+T+SV P N +K+P L+A Sbjct: 1277 TYVNATKEPKVDQNATAVPTSRENATSSVTSQPIVMNTTKQPVLNA 1322 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 27.5 bits (58), Expect = 9.6 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = +1 Query: 34 NFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTN 192 +F PPPP R PS T A ++P TR NK SR+ N Sbjct: 734 SFAPQRPPPPTRTPSGKDRPHSTTA----TPTLHIPERTRRNKKPKSRAEVVN 782 >SB_51678| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 351 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQG 473 DT+ +VN V +FES++ I++ R K+ GQG Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQG 214 >SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 27.5 bits (58), Expect = 9.6 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 375 DTNPINVNVVKRFESEETMIRHLIRLQKELGQG 473 DT+ +VN V +FES++ I++ R K+ GQG Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQG 214 >SB_21529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +3 Query: 96 IHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRR 248 +HQ+ L Q + + +QQ+ H+ Q QH+ + QQ+Q+ ++++ Sbjct: 290 LHQQHQLHQHQQ---QHQYQQQHQHQHQHQHQQQQQQQQQQQQQQQQQQQQ 337 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = +3 Query: 99 HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRR 248 HQ QQ+ + + + + Q+ H+ QQQ + + QQ+Q+ ++++ Sbjct: 294 HQLHQHQQQHQYQQQHQHQHQHQHQQQQQQQQQQQQQQQQQQQQQQQQQQ 343 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 52 PPPPLRYPSNP 84 PPPPLRYP +P Sbjct: 419 PPPPLRYPPSP 429 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,945,174 Number of Sequences: 59808 Number of extensions: 399746 Number of successful extensions: 1951 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 1562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1861 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -