BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120860.seq (628 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.4 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 22 5.6 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 81 MQGPAVFMDISLEDQALELRRYFKSLGAEISEEKSP 188 +Q P ++ SL D+A + + F++L + S E P Sbjct: 625 LQAPPLYDTNSLMDEAYKPHKKFRALRQKDSAEAEP 660 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 21.8 bits (44), Expect = 5.6 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -1 Query: 400 RLQSYHSKFRARSLSEPLTKC*DKVFSSF*WYRNH 296 RL+ + R EP+ +V+SS RNH Sbjct: 17 RLRRHIQNVHTRPSKEPICNICKRVYSSLNSLRNH 51 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,860 Number of Sequences: 438 Number of extensions: 3177 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -