BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120858.seq (620 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 27 0.64 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 0.84 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 24 3.4 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 24 4.5 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.8 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 26.6 bits (56), Expect = 0.64 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 504 GGNADLAEATDSLILFANEMIVARRDAETARQDCENAR 617 G NAD + SL +F + + AR +AE R+ +NAR Sbjct: 24 GRNADNFKLYSSLFVFPSPLQGARLEAEHVRRIHQNAR 61 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.2 bits (55), Expect = 0.84 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 285 RPALPRYLEHVLDLVGMLKRRFVLAV 208 R AL Y HV D+VG+L F+ A+ Sbjct: 2425 RKALQIYNSHVPDIVGVLNNHFMTAL 2450 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 24.2 bits (50), Expect = 3.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 186 TGNTCPRRRQVQIDV*ACRPNPAHAPD 266 T + PR VQI V A +PAH P+ Sbjct: 396 TRHVIPRHVGVQIPVYAIHHDPAHYPE 422 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 23.8 bits (49), Expect = 4.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 186 TGNTCPRRRQVQIDV*ACRPNPAHAPD 266 T + P+R VQI A + +P H PD Sbjct: 396 TKHVIPKRTLVQIPAYAIQRDPDHYPD 422 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 7.8 Identities = 4/8 (50%), Positives = 6/8 (75%) Frame = -1 Query: 266 IWSMCWIW 243 +W CW+W Sbjct: 787 VWDCCWVW 794 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 669,866 Number of Sequences: 2352 Number of extensions: 14340 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -