BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120858.seq (620 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19390.2 68418.m02311 pleckstrin homology (PH) domain-contain... 29 3.3 At5g19390.1 68418.m02310 pleckstrin homology (PH) domain-contain... 29 3.3 At2g02790.1 68415.m00222 calmodulin-binding family protein very ... 28 4.3 At5g08780.1 68418.m01041 histone H1/H5 family protein contains P... 28 5.7 At4g25320.1 68417.m03643 DNA-binding protein-related contains Pf... 28 5.7 At1g77060.1 68414.m08972 mutase family protein similar to carbox... 28 5.7 At1g70420.1 68414.m08102 expressed protein 28 5.7 At5g43490.1 68418.m05317 hypothetical protein similar to unknown... 27 7.6 At5g08630.1 68418.m01026 DDT domain-containing protein low simil... 27 7.6 >At5g19390.2 68418.m02311 pleckstrin homology (PH) domain-containing protein / RhoGAP domain-containing protein weak similarity to rho-GTPase activating protein [Homo sapiens] GI:14245732; contains Pfam profiles PF00169: PH domain, PF00620: RhoGAP domain Length = 870 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +1 Query: 58 QVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIR 198 Q G F DT +Y+ RF+ +D S+L YVN ER R Sbjct: 691 QTHFGSFSDARDTH--QYLQNHNPQKRFLQQDFDSTLAYVNHERKQR 735 >At5g19390.1 68418.m02310 pleckstrin homology (PH) domain-containing protein / RhoGAP domain-containing protein weak similarity to rho-GTPase activating protein [Homo sapiens] GI:14245732; contains Pfam profiles PF00169: PH domain, PF00620: RhoGAP domain Length = 822 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +1 Query: 58 QVKIGEFKFGEDTFTLRYVLGDEQPVRFVAKDIASSLKYVNCERAIR 198 Q G F DT +Y+ RF+ +D S+L YVN ER R Sbjct: 691 QTHFGSFSDARDTH--QYLQNHNPQKRFLQQDFDSTLAYVNHERKQR 735 >At2g02790.1 68415.m00222 calmodulin-binding family protein very low similarity to SP|P12036 Neurofilament triplet H protein {Homo sapiens}; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 636 Score = 28.3 bits (60), Expect = 4.3 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +2 Query: 185 NGQYVSTSTASTNRRLSMPTKSSTCSR*RG--KAGR--PAVFAPTHSAHYQI 328 NG S +T ++RR S+P K + G ++GR P+ APT SA +I Sbjct: 472 NGNVASENTKPSDRRASLPAKIENHHQDDGLTQSGRKIPSYMAPTASAKARI 523 >At5g08780.1 68418.m01041 histone H1/H5 family protein contains Pfam domain, PF00538: linker histone H1 and H5 family Length = 457 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 184 ERAIRVHVDGKYKST-FEHADQIQHMLQIAWQSRATRCICTHTQCSLP 324 E AI + KYK+ F H + + H L + R C C + SLP Sbjct: 77 EDAISEFIKSKYKNLPFAHTNLLSHHLAKLVEKREILCDCNNDCYSLP 124 >At4g25320.1 68417.m03643 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 404 Score = 27.9 bits (59), Expect = 5.7 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 203 TSTASTNRRLSMPTKSSTCSR*RGKAGRPAVFAP 304 T A+T L+MPT++++ + + K GRP + P Sbjct: 64 TENAATPFSLTMPTENTSAEQLKKKRGRPRKYNP 97 >At1g77060.1 68414.m08972 mutase family protein similar to carboxyvinyl-carboxyphosphonate phosphorylmutase GB:O49290 from [Arabidopsis thaliana]; similar to carboxyphosphonoenolpyruvate mutase (GI:47149) [Streptomyces hygroscopicus]; contains Prosite PS00161: Isocitrate lyase signature Length = 339 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 249 PAHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKS 356 P H PD + + G L +HP T L + + ++K+ Sbjct: 256 PLHTPDELKEMGFHLIVHPLTALYASTRALVDVLKT 291 >At1g70420.1 68414.m08102 expressed protein Length = 272 Score = 27.9 bits (59), Expect = 5.7 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +2 Query: 185 NGQYVSTSTASTNRRLSMPTKSSTCSR*RGKAGRPAVFAPTHSAHYQIW 331 NG ++ST+ST RLS KSS + + K + T SAH +++ Sbjct: 187 NGSSSTSSTSSTAARLSGVVKSSEKGKEKTKTDKKKDKMRTKSAHEKLY 235 >At5g43490.1 68418.m05317 hypothetical protein similar to unknown protein (gb|AAF20218.1) Length = 131 Score = 27.5 bits (58), Expect = 7.6 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +3 Query: 237 CRPNPAHAPDSVA--KQGDPLYLHPHTVLITKSGVIQLIMKSKLPYXIELQEWLL 395 C P+P A V + G+P PH L + ++ + + LP + QEWLL Sbjct: 33 CPPSPLAATMKVKVKENGEPSAKPPHPDLKYLNQILHVPTRELLPEIDDDQEWLL 87 >At5g08630.1 68418.m01026 DDT domain-containing protein low similarity to SP|Q9NRL2 Bromodomain adjacent to zinc finger domain protein 1A (ATP-utilizing chromatin assembly and remodeling factor 1) (ATP-dependent chromatin remodelling protein) (Williams syndrome transcription factor-related chromatin remodeling factor 180) {Homo sapiens}; contains Pfam profile PF02791: DDT domain Length = 723 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +1 Query: 376 NYKNGFWRRSFLKCYARRKYAPAVEMDTNDVIAKIDDLTQKL 501 ++K + R+FLK + R ++ ND +AK ++T+K+ Sbjct: 170 SWKKFPFSRNFLKSFIRDSTCHSIPWVVNDYLAKAHEITRKI 211 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,593,434 Number of Sequences: 28952 Number of extensions: 286807 Number of successful extensions: 727 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 727 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -