BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120857.seq (630 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4H3.05 |srs2||ATP-dependent DNA helicase, UvrD subfamily|Sch... 27 1.7 SPBC21C3.07c |||actin binding methyltransferase |Schizosaccharom... 25 6.8 >SPAC4H3.05 |srs2||ATP-dependent DNA helicase, UvrD subfamily|Schizosaccharomyces pombe|chr 1|||Manual Length = 887 Score = 27.5 bits (58), Expect = 1.7 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = +2 Query: 434 DKI*M*KFKILICSIIKILHDLSSNGVSQVGFYLLIFIIF*YERIKYYNY 583 DK + K +CSI K+ + SNG S LL+ I+ IKYY Y Sbjct: 476 DKSFLKSLKSFLCSISKLENRYLSNGHSATLSDLLLGIL---SEIKYYEY 522 >SPBC21C3.07c |||actin binding methyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 281 Score = 25.4 bits (53), Expect = 6.8 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +3 Query: 339 LIKRKNYLRDNSVIFFFSSNKKKSLRPRCWIKIKFK 446 ++ Y+R + + KK+ RCW++ KF+ Sbjct: 245 ILSENFYIRGDGTRVLIVNRKKRVKMYRCWLQAKFQ 280 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,994,719 Number of Sequences: 5004 Number of extensions: 32708 Number of successful extensions: 45 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -