BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120853.seq (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37483| Best HMM Match : Drf_FH1 (HMM E-Value=6.6) 33 0.20 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 32 0.46 SB_57324| Best HMM Match : ig (HMM E-Value=1e-26) 31 0.80 SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) 29 3.2 SB_46921| Best HMM Match : Endomucin (HMM E-Value=6.3) 29 3.2 SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 29 3.2 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 29 3.2 SB_28158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_36684| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_59142| Best HMM Match : RVT_1 (HMM E-Value=2.5e-09) 28 5.6 SB_52004| Best HMM Match : rve (HMM E-Value=1.2e-16) 28 5.6 SB_50931| Best HMM Match : Extensin_2 (HMM E-Value=0.14) 28 5.6 SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) 28 5.6 SB_43735| Best HMM Match : PHD (HMM E-Value=5.6e-06) 28 5.6 SB_41742| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_39020| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_34336| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_32984| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27) 28 5.6 SB_21933| Best HMM Match : RVT_1 (HMM E-Value=9.1e-27) 28 5.6 SB_20467| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_15028| Best HMM Match : Drf_FH1 (HMM E-Value=0.84) 28 5.6 SB_3510| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_1807| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_54014| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_51857| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 28 5.6 SB_47272| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_45059| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_41413| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_27634| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_27583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_25888| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_19509| Best HMM Match : rve (HMM E-Value=5.4e-26) 28 5.6 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 28 5.6 SB_16379| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_11418| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 5.6 SB_10464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 28 5.6 SB_4571| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_3197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_33431| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 28 7.4 SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) 28 7.4 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 28 7.4 SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) 28 7.4 SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) 28 7.4 SB_13666| Best HMM Match : IncA (HMM E-Value=3.7) 28 7.4 SB_6709| Best HMM Match : PCNA_C (HMM E-Value=9.8) 28 7.4 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 27 9.8 SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_39538| Best HMM Match : VWA (HMM E-Value=0) 27 9.8 SB_9228| Best HMM Match : GoLoco (HMM E-Value=4.2) 27 9.8 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 27 9.8 SB_51678| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 27 9.8 SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 27 9.8 >SB_37483| Best HMM Match : Drf_FH1 (HMM E-Value=6.6) Length = 237 Score = 33.1 bits (72), Expect = 0.20 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 7/82 (8%) Frame = +2 Query: 59 YYNTPPPPLRYP-----SNPATAIFTNAQTYNNAPGYVP--PTTRDNKMDTSRSNSTNSV 217 Y TP P + P S PA + Q + P Y P P + +M + S ST S Sbjct: 57 YTATPAPAQQAPHTTAASQPAPYTPASGQPASYTPAYTPYTPASTVGRMPPTTSQSTPSP 116 Query: 218 AIAPYNKSKEPTPTPANLFGTT 283 A P+ + + PTP L GT+ Sbjct: 117 A--PFFQQQPLVPTPVTLGGTS 136 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 31.9 bits (69), Expect = 0.46 Identities = 19/83 (22%), Positives = 37/83 (44%) Frame = +2 Query: 26 IKSMTDERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNS 205 +K + + ++ P PS P T + ++ + + P R K +S S+S Sbjct: 1079 VKESKEVKNKALPDSKPAVKSSPSPPPTKPRPSRRSLSKSVSKSPSPARKGKRSSS-SSS 1137 Query: 206 TNSVAIAPYNKSKEPTPTPANLF 274 + S + +P + + PTP P L+ Sbjct: 1138 SRSRSRSPRRRKRSPTPKPTKLY 1160 >SB_57324| Best HMM Match : ig (HMM E-Value=1e-26) Length = 947 Score = 31.1 bits (67), Expect = 0.80 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +1 Query: 166 DARQQNGHEPQQQHKLGSDRTVQQEQRTDADAGESIWYNKCVDFVQKI-IRYYRCNDMSE 342 D R++NGH Q + D T + D E NKC D V + Y NDM Sbjct: 834 DVRKENGHTIPQNKDIVKDTTGLNGVICNGDNSELRTQNKCTDEVARTEPNGYTDNDMDG 893 Query: 343 LSPL 354 LS + Sbjct: 894 LSDI 897 >SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 62 YNTPPPPLRYPSNPATAIFTNAQ 130 YNT PPPL +P++P ++ Q Sbjct: 58 YNTYPPPLSHPNDPTRGFYSPVQ 80 >SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1735 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/65 (26%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = +2 Query: 92 PSNPATAIFTNAQTYNNA---PGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTPTP 262 PS PAT ++ + + P Y P ++ T ST A P +K+ TP+ Sbjct: 280 PSCPATLVYEKSSQQKGSEETPSYAPTQMYSSEHTTGSLQSTQPTAEPPIDKTPSKTPSK 339 Query: 263 ANLFG 277 G Sbjct: 340 VKPHG 344 >SB_13884| Best HMM Match : LRR_1 (HMM E-Value=6.3e-06) Length = 575 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +2 Query: 41 DERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRD-NKMDTSRSN 202 +ERG ++ +PS P TA FTN + V P +R+ N++ SRS+ Sbjct: 511 EERGYGHFIKTRTGDPHPSYPLTASFTNYPLLSTLDPLVAPLSRELNQLPASRSH 565 >SB_46921| Best HMM Match : Endomucin (HMM E-Value=6.3) Length = 312 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/64 (25%), Positives = 27/64 (42%), Gaps = 7/64 (10%) Frame = +2 Query: 92 PSNPATAIFTNAQTYNNAPGY-------VPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEP 250 PS P ++ + + T P + +PPT + +S S T V +P ++ Sbjct: 49 PSLPTSSTHSTSPTVQTTPAFTTSPATILPPTAKTTSSTSSTSKPTEDVGTSPQPSTENE 108 Query: 251 TPTP 262 T TP Sbjct: 109 THTP 112 >SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 917 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 74 PPPLRYPSN-PATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNS 214 PP R+PS P+ NA + +N P Y P D+ D S + +S Sbjct: 550 PPEYRFPSEEPSPYAEENAISRSNPPVYTPKEEDDDDDDDEESETEDS 597 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/67 (25%), Positives = 31/67 (46%) Frame = +2 Query: 65 NTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSK 244 N+ P RY P+ +T+ +Y + Y P T+ S +++T+ + Y + Sbjct: 129 NSATRPPRYTPTPS---YTSTTSYTSTTSYTPTTS--YTPTPSYTSTTSYTSTTSYTSTT 183 Query: 245 EPTPTPA 265 TPTP+ Sbjct: 184 SYTPTPS 190 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = +2 Query: 71 PPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEP 250 PP PS +T +T+ +Y Y P T TS +++T+ + Y + Sbjct: 134 PPRYTPTPSYTSTTSYTSTTSYTPTTSYTP--TPSYTSTTSYTSTTSYTSTTSYTPTPSY 191 Query: 251 TPTPA 265 T TP+ Sbjct: 192 TSTPS 196 >SB_28158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 28.7 bits (61), Expect = 4.2 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = +2 Query: 92 PSNPATAIFTNA-QTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEP-TPTPA 265 P++ T F N+ + N + P + RDN +DTS ++ + + NK++ TP Sbjct: 132 PNDNNTLSFDNSFNPFRNKSTWTPSSGRDNSLDTSPNSVKLQIQNSTLNKTRSNITPGER 191 Query: 266 NLFGTTN 286 N N Sbjct: 192 NALTQLN 198 >SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1146 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 121 QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTD 252 Q QQ + +D +QQ H+ QQQH QQ+QR D Sbjct: 1078 QHDQQQQNTGQQQQHDKQQQ--HDQQQQHDQQQQHDQQQQQRHD 1119 >SB_36684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 28.7 bits (61), Expect = 4.2 Identities = 27/114 (23%), Positives = 44/114 (38%), Gaps = 6/114 (5%) Frame = +1 Query: 187 HEPQQQHKLGSDRTVQQEQRTDADAGESIWYNKC-VDFVQKIIRYYRCNDMSEL-----S 348 HE +Q+ K + + + + T A GE Y C +FV+ I Y C ++ S Sbjct: 61 HETEQEQKREMEEDLNK-RLTKARDGERCKYENCNTEFVRNINECYCCTELEGCMEALQS 119 Query: 349 PLMIHFINTIRDMCIDTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAESR 510 L++ + C+ +P V S + L R KE + E R Sbjct: 120 DLVVQDLEPCTKKCVTEHPGFAPVCLEKWSLRMAAKKLRRRDKETYKQTGTEER 173 >SB_59142| Best HMM Match : RVT_1 (HMM E-Value=2.5e-09) Length = 772 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_52004| Best HMM Match : rve (HMM E-Value=1.2e-16) Length = 869 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_50931| Best HMM Match : Extensin_2 (HMM E-Value=0.14) Length = 348 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +2 Query: 119 TNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTPTPANL 271 T++++ N+ G +P T DN + N A A + +K PA++ Sbjct: 61 TSSESSTNSTGAIPATKPDNSKPQDKETELNQTASATPSNAKPRGKKPASV 111 >SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) Length = 2086 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +2 Query: 92 PSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTPTPA 265 PS+ T + T A P T D+K T + +TN+ P + + +P PT A Sbjct: 1780 PSSAKTTTRPASTTKKLATSSTKPAT-DDKKQTKPATTTNASKTRPASSAAKPKPTSA 1836 >SB_43735| Best HMM Match : PHD (HMM E-Value=5.6e-06) Length = 772 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_41742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1061 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_39020| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 319 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 126 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 161 >SB_34336| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 374 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_32984| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 361 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27) Length = 1036 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_21933| Best HMM Match : RVT_1 (HMM E-Value=9.1e-27) Length = 510 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_20467| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 317 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_15028| Best HMM Match : Drf_FH1 (HMM E-Value=0.84) Length = 944 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +2 Query: 92 PSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTPTPA 265 PS+ T + T A P T D+K T + +TN+ P + + +P PT A Sbjct: 638 PSSAKTTTRPASTTKKLATSSTKPAT-DDKKQTKPATTTNASKTRPASSAAKPKPTSA 694 >SB_3510| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 272 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 130 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 165 >SB_1807| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 281 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_54014| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 176 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_51857| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 438 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 130 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 165 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_47272| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 737 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 430 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 465 >SB_45059| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 519 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_41413| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 471 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 160 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 195 >SB_27634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 149 GYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTPTP 262 GY +++ +K ++ S++T+ P S P PTP Sbjct: 57 GYAAKSSKSSKSSSTSSSTTHGPTPVPATPSSPPRPTP 94 >SB_27583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_25888| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 606 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_19509| Best HMM Match : rve (HMM E-Value=5.4e-26) Length = 1195 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 130 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 165 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/67 (28%), Positives = 26/67 (38%), Gaps = 5/67 (7%) Frame = +2 Query: 71 PPPPLRYPSNP---ATAIFTNAQTYNNAPGYVPPTTRDNKMDTS--RSNSTNSVAIAPYN 235 PPPP PSN +N Y AP PP + + +N S + YN Sbjct: 510 PPPPRNQPSNQNWNQNYDQSNQNMYGPAPPPPPPQQQQQQSQAQPLMTNQQQSYSTQQYN 569 Query: 236 KSKEPTP 256 +S + P Sbjct: 570 QSYQQQP 576 >SB_16379| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 499 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 77 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 112 >SB_11418| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 292 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 80 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 115 >SB_10464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 10 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 45 >SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 960 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_4571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 635 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 670 >SB_3197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1246 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ +VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_33431| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 377 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETGVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) Length = 509 Score = 27.9 bits (59), Expect = 7.4 Identities = 18/73 (24%), Positives = 23/73 (31%) Frame = +2 Query: 65 NTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSK 244 NT PP P+ P T T PP T T+ + + P + Sbjct: 66 NTTPPATTTPTKPTTTTPPATTTPTTPTTTTPPATTTPTKPTTTTPPATTTPTKPTTTTP 125 Query: 245 EPTPTPANLFGTT 283 T TP TT Sbjct: 126 PGTTTPTKPTTTT 138 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +2 Query: 68 TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 247 +P P PS+P+ + + + + +PGY P + S S S S + +P + S Sbjct: 413 SPSSPAFMPSSPSMSPASPSYS-PTSPGYSPSSPSSGYSPASPSYSPTSPSYSPTSPSYS 471 Query: 248 PT 253 PT Sbjct: 472 PT 473 >SB_31885| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28) Length = 922 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQGNAAES 507 DT+ VN V +FES++ I++ R K+ GQG ++ Sbjct: 184 DTSETGVNAVSKFESKKPNIKNYRR--KQRGQGKQCDN 219 >SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) Length = 592 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/67 (25%), Positives = 34/67 (50%) Frame = +2 Query: 20 VQIKSMTDERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRS 199 V+ K + E+ + +P P +R S I+T + T + Y + R +++ TS+ Sbjct: 209 VEEKIESSEKFSEKSESPEPSVRVDSETGDEIYTVSATPSETESYATTSMR-SRVSTSKG 267 Query: 200 NSTNSVA 220 +S+ SV+ Sbjct: 268 SSSPSVS 274 >SB_13666| Best HMM Match : IncA (HMM E-Value=3.7) Length = 476 Score = 27.9 bits (59), Expect = 7.4 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 2/72 (2%) Frame = +2 Query: 59 YYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIA-PYN 235 Y +PPPP NP + N P + PT D S ++ + ++ +A PY Sbjct: 365 YKCSPPPPQVDIMNPFALLALNPAIQCANPSLLDPTLNS---DVSNASDSQALGVATPYL 421 Query: 236 KS-KEPTPTPAN 268 E PTPA+ Sbjct: 422 PDVGEVPPTPAD 433 >SB_6709| Best HMM Match : PCNA_C (HMM E-Value=9.8) Length = 279 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +2 Query: 77 PPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNK 238 PP + +P + N +++ P Y PP D + T RS S +V A Y + Sbjct: 144 PPSSHSRSPNSPGSPNPTLFSH-PSYYPPPPLDFQAGTKRSASCMAVVEADYGR 196 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 50 GNFYYNTPPPPLRYPSNPATAIF-TNAQTYNNAPGYVPPTTRDNKMD 187 G + PPP L++ N + A+F ++ N++ + P ++R D Sbjct: 268 GRYQRKGPPPRLKFSRNSSPALFPASSMCENSSLSFYPASSRGGSPD 314 >SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/47 (29%), Positives = 18/47 (38%) Frame = +2 Query: 119 TNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTPT 259 T QT P PTT T + ST ++P + P PT Sbjct: 285 TTQQTTATLPSTKQPTTTQQTTATLPTPSTKPTTVSPTTRQPPPEPT 331 >SB_39538| Best HMM Match : VWA (HMM E-Value=0) Length = 3208 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/50 (22%), Positives = 26/50 (52%) Frame = +1 Query: 100 SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRT 249 S N H+ R ++++R+R +A + +P+++ +L R ++ T Sbjct: 3012 SRNDHVQSRFGAREKSRIRRGIEAILRGRTKPRRRRRLNKSRRRTHKKTT 3061 >SB_9228| Best HMM Match : GoLoco (HMM E-Value=4.2) Length = 171 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +2 Query: 95 SNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPTPTPA 265 S P + +++Y N+ ++ + +S S+S NS A + K +P P A Sbjct: 108 SKPTGPSYKQSKSYKNSTTVTTKRSQASPSSSSSSSSVNSTAGSSRTKPAKPAPMAA 164 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/53 (33%), Positives = 22/53 (41%) Frame = +2 Query: 53 NFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTN 211 +F PPPP R PS T A ++P TR NK SR+ N Sbjct: 734 SFAPQRPPPPTRTPSGKDRPHSTTA----TPTLHIPERTRRNKKPKSRAEVVN 782 >SB_51678| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 351 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQG 492 DT+ +VN V +FES++ I++ R K+ GQG Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQG 214 >SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 394 DTNPINVNVVKRFESEETMIRHLIRLQKELGQG 492 DT+ +VN V +FES++ I++ R K+ GQG Sbjct: 184 DTSETDVNAVSKFESKKPNIKNYRR--KQRGQG 214 >SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = +1 Query: 274 WYNKCVDFVQKIIRYYRCNDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESE-ETM 450 W CV V DM LSP ++ + C + + ++RF E + Sbjct: 898 WLEMCVVHVSTFTAELSITDMHSLSPSVLKVAKYAYEHCQQSEVLYGTFLQRFSEELSAI 957 Query: 451 IRHLIRLQKEL 483 + +LQK L Sbjct: 958 FKKAYQLQKAL 968 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 27.5 bits (58), Expect = 9.8 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +2 Query: 71 PPPPLRYPSNP 103 PPPPLRYP +P Sbjct: 419 PPPPLRYPPSP 429 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,097,330 Number of Sequences: 59808 Number of extensions: 403986 Number of successful extensions: 1908 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 1521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1849 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -